DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG30082

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:408 Identity:93/408 - (22%)
Similarity:137/408 - (33%) Gaps:168/408 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SWLCLLLLLPSSR-QF-ETDCGCR----PARRGPRIIAGAATNEGQFPWQASLELLHPSLGFLGH 110
            |:..|:.|.|..| || :.:||..    |..   ||:.|...:.|..||   |..||.:...:  
  Fly     8 SFAFLVCLTPKLRAQFIDPNCGTTINLPPTN---RIVGGRTADIGSNPW---LAYLHKNSSLV-- 64

  Fly   111 WCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHDRD--VESGNEQRIPV-EKIVMHHRY 172
             |...||.:.::|:||||:|:  |:     |.||.|||:|..  ::..:|..||. |:..:.:.|
  Fly    65 -CTGTLITKRFVLTAAHCLHS--FH-----LLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAY 121

  Fly   173 -HNF-------KHDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLI 229
             |.|       ::|:.|:||:  ..:.....||.||    |...|.|.      |.||..|    
  Fly   122 IHTFFGGRQDSRNDIGLLKLN--GTVVYKLFIRPIC----LFRDPGQV------PYSSTYE---- 170

  Fly   230 QQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRND 294
                                                                             
  Fly   171 ----------------------------------------------------------------- 170

  Fly   295 KLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLS-----NQLLKTQVPLH 354
                                               |.||||.::....:     |.:...|....
  Fly   171 -----------------------------------AAGWGKIDLINTATVLQTVNLIRLDQSDCE 200

  Fly   355 QNGRCRDAYGSFVNIHGGHLCAGKLNGEGGTCVGDSGGPLQCRLS--RDGPWILVGVTSFGSGCA 417
            ::.|...:||.|        |||:...:  ||.|||||||..::|  |....:.:|:.|:|.  .
  Fly   201 RSLRTSLSYGQF--------CAGQWRAD--TCSGDSGGPLSRKMSNGRITRTVQLGIVSYGH--Y 253

  Fly   418 LEGFPDVYTRTSYYMKWI 435
            |...|.|||....:..||
  Fly   254 LCRGPGVYTYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 81/372 (22%)
Tryp_SPc 81..438 CDD:238113 82/373 (22%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 81/372 (22%)
Tryp_SPc 40..274 CDD:238113 82/373 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.