DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and F11

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_005262878.1 Gene:F11 / 2160 HGNCID:3529 Length:626 Species:Homo sapiens


Alignment Length:417 Identity:94/417 - (22%)
Similarity:146/417 - (35%) Gaps:156/417 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SQSQCHWQIPATSTAT--------LSWLCLLLLLPSSRQFETDCGCRPARRGPRIIAGAATNEGQ 91
            ::.:|:.::.:..:.|        :|...|.|.     :.:.:|   ..:..|||:.|.|:..|:
Human   343 NRGKCYLKLSSNGSPTKILHGRGGISGYTLRLC-----KMDNEC---TTKIKPRIVGGTASVRGE 399

  Fly    92 FPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWTVVLGEHDRDVESG 156
            :|||.:|....|:   ..|.||..:|...|||:||||    .:.:..|.:..|..|..::.....
Human   400 WPWQVTLHTTSPT---QRHLCGGSIIGNQWILTAAHC----FYGVESPKILRVYSGILNQSEIKE 457

  Fly   157 NEQRIPVEKIVMHHRYHNFK--HDVVLMKLSKPADLTRASNIRRICLPFLLAESPDQAQSETVSP 219
            :.....|::|::|.:|...:  :|:.|:||....:.|.:.  |.|||                  
Human   458 DTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVNYTDSQ--RPICL------------------ 502

  Fly   220 PSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKILSRMRQALAQRSPR 284
            ||..|.:|:                                                        
Human   503 PSKGDRNVI-------------------------------------------------------- 511

  Fly   285 SHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGKANISGDLSNQLLKT 349
                                                    :.||..||||...:...:.|.|.|.
Human   512 ----------------------------------------YTDCWVTGWGYRKLRDKIQNTLQKA 536

  Fly   350 QVPLHQNGRCRDAYGSFVNIHGGH------LCAGKLNGEGGTCVGDSGGPLQCRLSRDGPWILVG 408
            ::||..|..|:..|       .||      :|||...|....|.|||||||.|:  .:..|.|||
Human   537 KIPLVTNEECQKRY-------RGHKITHKMICAGYREGGKDACKGDSGGPLSCK--HNEVWHLVG 592

  Fly   409 VTSFGSGCALEGFPDVYTRTSYYMKWI 435
            :||:|.|||....|.|||....|:.||
Human   593 ITSWGEGCAQRERPGVYTNVVEYVDWI 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 85/362 (23%)
Tryp_SPc 81..438 CDD:238113 86/363 (24%)
F11XP_005262878.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..375 CDD:128519 4/31 (13%)
Tryp_SPc 388..619 CDD:214473 85/362 (23%)
Tryp_SPc 389..619 CDD:238113 84/361 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
21.870

Return to query results.
Submit another query.