DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and CG12256

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:367 Identity:79/367 - (21%)
Similarity:121/367 - (32%) Gaps:141/367 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RIIAGAATNEGQF-PWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVHNDLFNLPIPPLWT 143
            |::.|....|.:: |:|.|::.|..| |.:.|:||..||....:|:|||||:....:     ..:
  Fly    46 RVVGGYDVPEDEYVPYQVSMQFLTRS-GKMRHFCGGSLIAPNRVLTAAHCVNGQNAS-----RIS 104

  Fly   144 VVLGEHDRDVESGNEQRIPVEKIVMHHRYHNF-KHDVVLMKLSKPADL--TRASNIRRICLPFLL 205
            ||.|..|.:..||  .|..|:...|:..|... ..|:.::|:..|.:|  .|.|.|         
  Fly   105 VVAGIRDLNDSSG--FRSQVQSYEMNENYQELVTSDIAILKIDPPFELDEKRVSTI--------- 158

  Fly   206 AESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNVTAPSMKELMNMKI 270
                |.:.|:.|    .||::||:                                         
  Fly   159 ----DVSGSDMV----GADQEVLL----------------------------------------- 174

  Fly   271 LSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKEIAFVDCVATGWGK 335
                                                                        ||||.
  Fly   175 ------------------------------------------------------------TGWGS 179

  Fly   336 ANISG-----DLSNQLLKTQVPLHQNGRCRDAYGSFVNIHGGHLCAGKLNGEGGTCVGDSGGPLQ 395
            ....|     .....|.|.......|.:|::   :...:....:||.:..|: |.|.|||||||.
  Fly   180 VFHFGTGPFAKYPTVLQKLDYKTLSNSKCKE---TMTQLTDTEICALERFGK-GACNGDSGGPLV 240

  Fly   396 CRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWIED 437
            .:....  :..|||.|:|:.......||||||.|.:..||::
  Fly   241 MKSGES--YKQVGVVSYGTAFCASNNPDVYTRVSMFDGWIKE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 77/363 (21%)
Tryp_SPc 81..438 CDD:238113 78/366 (21%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 77/363 (21%)
Tryp_SPc 47..280 CDD:238113 78/364 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.