DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14892 and Tmprss12

DIOPT Version :9

Sequence 1:NP_650562.1 Gene:CG14892 / 42016 FlyBaseID:FBgn0038447 Length:442 Species:Drosophila melanogaster
Sequence 2:XP_038936305.1 Gene:Tmprss12 / 100362912 RGDID:2323781 Length:427 Species:Rattus norvegicus


Alignment Length:379 Identity:88/379 - (23%)
Similarity:124/379 - (32%) Gaps:141/379 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CGCRPAR---RGPRIIAGAATNEGQFPWQASLELLHPSLGFLGHWCGAVLIHQYWILSAAHCVH- 130
            ||..|.|   .|.|||.|...|.|.:|||.||::...:  ||.|.||..|:...|:|:||||.. 
  Rat   142 CGIAPLRGALEGSRIIGGMQANAGAWPWQVSLQVQDGN--FLVHVCGGALVRDRWVLTAAHCTKE 204

  Fly   131 -NDLFNLPIPPLWTVVLGEHDRDVESGNEQRIPVEKIVMHHRY--HNFKHDVVLMKLSKPADLTR 192
             :|      |..|..|:|..|......:.:.:.|..||:...:  ..|.:|:.|..|.|.     
  Rat   205 ASD------PLKWRAVIGTTDLTRSHSHSRSVRVSDIVIQPDFILETFVNDIALFHLKKA----- 258

  Fly   193 ASNIRRICLPFLLAESPDQAQSETVSPPSSADEDVLIQQLELEDVPEKIDNFLRSVQSRRRYRNV 257
                                                                :|:|...|.|.. 
  Rat   259 ----------------------------------------------------VRTVLQNRGYGG- 270

  Fly   258 TAPSMKELMNMKILSRMRQALAQRSPRSHKRSRRRNDKLMKLGPRRDSDDSAEQKHPKVSDEPKE 322
                                                   .:|.|.:                   
  Rat   271 ---------------------------------------QRLSPWK------------------- 277

  Fly   323 IAFVDCVATGWGK----ANISGDLSNQLLKTQVPLHQNGRCRD--AYGSFVNIHGGHLCAGKLNG 381
              ...||...|.|    :...|:.:..|.:.:|.......|..  :||..  |.....|||..||
  Rat   278 --LHTCVIPEWAKTIRRSGAPGNGTTILQEAKVHFISREICNSDRSYGGV--IPNTSFCAGHENG 338

  Fly   382 EGGTCVGDSGGPLQCRLSRDGPWILVGVTSFGSGCALEGFPDVYTRTSYYMKWI 435
            ...||.|||||||.|.|:....:.::||||:|.||....||.||:..|::.:|:
  Rat   339 TFDTCRGDSGGPLMCYLTEHKRYFVMGVTSYGHGCGRRHFPGVYSSPSFFQQWL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14892NP_650562.1 Tryp_SPc 80..435 CDD:214473 82/364 (23%)
Tryp_SPc 81..438 CDD:238113 82/365 (22%)
Tmprss12XP_038936305.1 Tryp_SPc 155..391 CDD:214473 82/363 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D528095at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.