DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scp2 and AT4G27790

DIOPT Version :9

Sequence 1:NP_524381.1 Gene:Scp2 / 42015 FlyBaseID:FBgn0020907 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_194508.1 Gene:AT4G27790 / 828892 AraportID:AT4G27790 Length:345 Species:Arabidopsis thaliana


Alignment Length:183 Identity:37/183 - (20%)
Similarity:69/183 - (37%) Gaps:38/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KLLFLFNVFFDVNQSGEIDVKDFELAIERVCQLRGWQKDTPKNKETYDLMMEIWTGLRSKADKDN 74
            ::.|||.:.....:.|.:.:|          :|:.|.....::...|....|:     ...|||.
plant    95 RIKFLFPLLDASPRDGFVSLK----------ELQTWMMQQTEDNMVYRTAKEL-----ELQDKDK 144

  Fly    75 DGQVSVDEWCNMW-----DAYAKDPSSVMDWQNAYMNFMFDLEDASHDGGIDVTEFTLVC----S 130
            ||.::.:|:...:     :...|.......|...:.|..||     |:|.:|:.||....    |
plant   145 DGVITFEEYLPQFSKQDIEKNEKGHGEAGWWMEQFKNSDFD-----HNGSLDIEEFNNFLHPEDS 204

  Fly   131 SYG-LEKTECEEAFAKM-SQGQSEVTREQFA----ALWKEYF---AAEDVNAP 174
            ..| .::...:|....| :.|..::..::|.    .::||:.   ..||.|.|
plant   205 RNGDTQRWVLKERMTGMDTNGDGKLEYKEFVKNAYEMYKEFAKFEKEEDENVP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Scp2NP_524381.1 EFh 10..87 CDD:298682 15/76 (20%)
EF-hand_7 14..86 CDD:290234 14/71 (20%)
FRQ1 71..163 CDD:227455 22/106 (21%)
AT4G27790NP_194508.1 EFh_CREC 95..325 CDD:330175 37/183 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10827
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.