DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scp2 and cex-1

DIOPT Version :9

Sequence 1:NP_524381.1 Gene:Scp2 / 42015 FlyBaseID:FBgn0020907 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_495034.1 Gene:cex-1 / 186376 WormBaseID:WBGene00023407 Length:204 Species:Caenorhabditis elegans


Alignment Length:188 Identity:62/188 - (32%)
Similarity:100/188 - (53%) Gaps:11/188 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISDFRKKKLLFLFNVFFDVNQSGEIDVKDFELAIERVCQLRGWQK-DTPKNKETYDLMMEIWTGL 66
            :..|..||...:|::|||.|.|.::|..||.|.:::|..:.|.:. .|...|::   :..:|.||
 Worm    22 VDPFLVKKWERIFSLFFDRNASHQVDWGDFYLVVKKVRDIYGAESVQTGFAKKS---LAALWEGL 83

  Fly    67 RSKADKDNDGQVSVDEWCNMWDAYAKDPSSVMDWQNAYMNFMFDLEDASHDGGIDVTEFTLVCSS 131
            .|.||.|.|..:|:|||..:  ....|..:...|...|.||||.|.|.|.||.:|:.|:|...|:
 Worm    84 CSIADADKDQLISIDEWIGL--LKKTDAKTEPKWFKDYQNFMFKLFDVSCDGVMDLAEYTDGMST 146

  Fly   132 YGLEKTECEEAFAKMS---QGQ--SEVTREQFAALWKEYFAAEDVNAPGNYIFGKTSF 184
            ||.:::||:.||.|.|   :||  .::..|.:...:.:.|.:.:.:..||::||...|
 Worm   147 YGFDQSECDAAFHKFSVDKKGQYVPQMKPETWNTYFHQLFYSTNKSDVGNHLFGIIDF 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Scp2NP_524381.1 EFh 10..87 CDD:298682 27/77 (35%)
EF-hand_7 14..86 CDD:290234 26/72 (36%)
FRQ1 71..163 CDD:227455 34/96 (35%)
cex-1NP_495034.1 EF-hand_7 85..144 CDD:290234 24/60 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AGE0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46418
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014253
OrthoInspector 1 1.000 - - otm14277
orthoMCL 1 0.900 - - OOG6_111862
Panther 1 1.100 - - LDO PTHR10827
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.