DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scp2 and CETN3

DIOPT Version :9

Sequence 1:NP_524381.1 Gene:Scp2 / 42015 FlyBaseID:FBgn0020907 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001284694.1 Gene:CETN3 / 1070 HGNCID:1868 Length:191 Species:Homo sapiens


Alignment Length:194 Identity:35/194 - (18%)
Similarity:72/194 - (37%) Gaps:64/194 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ISDFRKKKLLFLFNVFFDVNQSGEIDVKDFELAIERVCQLRGW---QKDTPKNKETYDLMMEIWT 64
            :|:.:|:::...|.: ||.::...||..:.::|:..:    |:   :.|..|..:.|        
Human    22 LSEEQKQEIKDAFEL-FDTDKDEAIDYHELKVAMRAL----GFDVKKADVLKILKDY-------- 73

  Fly    65 GLRSKADKDNDGQVSVDEWCNMWDAYAKDPSSVMDW---QNAYMNFM--FDLEDASHDGGIDVTE 124
                  |::..|:::.:::..:          |.||   ::.:...:  |.|.|....|.|.:..
Human    74 ------DREATGKITFEDFNEV----------VTDWILERDPHEEILKAFKLFDDDDSGKISLRN 122

  Fly   125 FTLVCSSYGLEKTECE-----EAFAKMSQGQ----------------------SEVTREQFAAL 161
            ...|....|...::.|     |.|.|...|:                      |||.:|:|.|:
Human   123 LRRVARELGENMSDEELRAMIEEFDKDGDGEILKNILLLPIWSRCLSLNREFFSEVNQEEFIAI 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Scp2NP_524381.1 EFh 10..87 CDD:298682 12/79 (15%)
EF-hand_7 14..86 CDD:290234 12/74 (16%)
FRQ1 71..163 CDD:227455 23/123 (19%)
CETN3NP_001284694.1 PTZ00183 15..190 CDD:185503 35/194 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.