DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14903 and CG14297

DIOPT Version :10

Sequence 1:NP_650561.1 Gene:CG14903 / 42014 FlyBaseID:FBgn0038446 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_650756.1 Gene:CG14297 / 42260 FlyBaseID:FBgn0038655 Length:250 Species:Drosophila melanogaster


Alignment Length:120 Identity:23/120 - (19%)
Similarity:44/120 - (36%) Gaps:25/120 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YIVVRSD--LRSALSWPLGAVIAQSCHATAAVIHLNSEDADTV-AYLNDLDNMHKVVLEAKDESA 68
            |:|...:  .:..|.|.......:.|.    |:.|:|...:.: |:::.|...||:   ....||
  Fly    83 YVVAMDEAVFKELLLWAADNRAGKHCQ----VLLLSSFGKNGLPAFIDSLSPTHKL---KNFRSA 140

  Fly    69 LVKLSEKLKENEIKHK---------------LWIEQPENIPTCIALKPYVKDTVH 108
            ..::.|..|:..:..|               |:....:|.|...|...::.:|.|
  Fly   141 YYQIKECCKQLILSQKVDIVKYELPSTDDDELYYSGKDNAPQDSAKANHLTETSH 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14903NP_650561.1 PTH2_like 4..117 CDD:239107 23/120 (19%)
CG14297NP_650756.1 LMWPTP 4..152 CDD:319971 16/75 (21%)

Return to query results.
Submit another query.