DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14891 and FBXL20

DIOPT Version :10

Sequence 1:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001357137.2 Gene:FBXL20 / 84961 HGNCID:24679 Length:438 Species:Homo sapiens


Alignment Length:303 Identity:75/303 - (24%)
Similarity:123/303 - (40%) Gaps:58/303 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 NITNISLRRCNLKDAHIYCLQM---LSKLKSLDIRENFSIKGDSLKSL----PISLEILNVSGCV 295
            ||..::|..|. |.....|..:   .|||:.||:....||...|||:|    |: ||.||:|.| 
Human   120 NIEVLNLNGCT-KTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPL-LEQLNISWC- 181

  Fly   296 DLSPKCLIQ--LAALSHLRELRCPGIVKFAKDNELYGRLAHYCPMLEVLELTDFMNVIQLG---- 354
            |...|..||  :.....|:.|...|..:.  ::|....:..:||.|..|.|...:.:...|    
Human   182 DQVTKDGIQALVRGCGGLKALFLKGCTQL--EDEALKYIGAHCPELVTLNLQTCLQITDEGLITI 244

  Fly   355 --GLSRLHTLVIHSSAQLDYHVNNVLLTSIAESY-SLRHLEILDSFGPMSDTSF----------- 405
              |..:|.:|.....:    ::.:.:|.::.::. .||.||:. ....::|..|           
Human   245 CRGCHKLQSLCASGCS----NITDAILNALGQNCPRLRILEVA-RCSQLTDVGFTTLARNCHELE 304

  Fly   406 --DLSIFSQLKE--LRTLILHNQNFTTLHLM--------GLQKLST-------LEFLDLSGSPNL 451
              ||....|:.:  |..|.:|......|.|.        |::.|..       ||.::|...|.:
Human   305 KMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLI 369

  Fly   452 SNEVVAKLTKSLSGLRRLKVDFCPLITRQLTKILEGN-PKLQV 493
            ::..:..| ||...|.|:::..|..|||...|.|..: |.::|
Human   370 TDASLEHL-KSCHSLERIELYDCQQITRAGIKRLRTHLPNIKV 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14891NP_650560.1 RRM 41..92 CDD:214636
leucine-rich repeat 211..237 CDD:275381
LRR <235..>463 CDD:443914 64/270 (24%)
leucine-rich repeat 239..262 CDD:275381 5/25 (20%)
leucine-rich repeat 263..285 CDD:275381 10/25 (40%)
leucine-rich repeat 286..338 CDD:275381 15/53 (28%)
leucine-rich repeat 339..387 CDD:275381 8/54 (15%)
leucine-rich repeat 388..415 CDD:275381 9/39 (23%)
leucine-rich repeat 416..439 CDD:275381 7/30 (23%)
leucine-rich repeat 440..465 CDD:275381 7/24 (29%)
FBXL20NP_001357137.2 F-box_FBXL2-like 24..68 CDD:438887
leucine-rich repeat 67..94 CDD:275381
AMN1 95..291 CDD:187754 46/180 (26%)
leucine-rich repeat 95..114 CDD:275381
leucine-rich repeat 121..146 CDD:275381 5/25 (20%)
leucine-rich repeat 147..172 CDD:275381 9/24 (38%)
leucine-rich repeat 173..198 CDD:275381 10/25 (40%)
leucine-rich repeat 199..224 CDD:275381 5/26 (19%)
AMN1 222..396 CDD:187754 37/179 (21%)
leucine-rich repeat 225..250 CDD:275381 5/24 (21%)
leucine-rich repeat 251..276 CDD:275381 3/28 (11%)
leucine-rich repeat 277..302 CDD:275381 6/25 (24%)
leucine-rich repeat 303..328 CDD:275381 6/24 (25%)
leucine-rich repeat 329..357 CDD:275381 4/27 (15%)
leucine-rich repeat 358..382 CDD:275381 7/24 (29%)
leucine-rich repeat 383..408 CDD:275381 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.