DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14891 and AT4G30640

DIOPT Version :10

Sequence 1:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_567849.1 Gene:AT4G30640 / 829187 AraportID:AT4G30640 Length:301 Species:Arabidopsis thaliana


Alignment Length:368 Identity:79/368 - (21%)
Similarity:127/368 - (34%) Gaps:145/368 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 GGPLHPNWPYLTE------FVQL------LGV---------SC--PNLT-----ELSFFKISVSL 223
            |..|:|:|..||.      |.:|      :|.         :|  |.|.     |..|.....|:
plant    13 GSGLYPDWSELTRECLLDIFSRLSQEQRWIGPMLVSKNWMNACYDPTLNTIFDLETRFLSFPESI 77

  Fly   224 AHMTHLF------------DGANGLINITNISLRRCNLKDAHIYCLQMLSKLKSLDIRENFSIKG 276
            ...|..|            |.:.|  .:|.|.:|.|.              .:||..        
plant    78 NWWTPEFEDKVDSFLRSVVDRSEG--GLTEIRIRHCT--------------ERSLSY-------- 118

  Fly   277 DSLKSLPISLEILNVSGCVDLSPKCLIQLAALSHLRELRCPGI------VKFAKDNELYGRLAHY 335
             :.:..| :||:|.:..|.:::...:.::|       :.||.:      ..:...:|....|...
plant   119 -AAERCP-NLEVLWIKNCPNVTDASMEKIA-------MNCPNLRELDISYSYGITHESLITLGRS 174

  Fly   336 CPMLEVLELTDFMNVIQLGGLSRLHTLVIHSSAQLDY-----HVNNVLLTSIAESYS-LRHLEIL 394
            |..|::|:    .|::...|.| |.|:|    |.|||     ...|:....|.:..: |:|||| 
plant   175 CQNLKILK----RNLLPRLGPS-LPTIV----APLDYLATFPRYGNIEARIIGKYMTQLKHLEI- 229

  Fly   395 DSFGPMSDTSFDLSIFSQLKELRTLILHNQNFTTLHLMGLQKL----STLEFLDLSGSPNLSNEV 455
                                          .::||...||..:    |.||::||.|..:|:.  
plant   230 ------------------------------RYSTLTARGLDSVCKGCSNLEYMDLRGCISLTR-- 262

  Fly   456 VAKLTKSLSGLRRL----KVDFCPLITRQLTKILE----GNPK 490
             :.:..:.|||:.|    |.||.|.|.     :|.    |||:
plant   263 -SDINTNTSGLKNLTEIIKPDFNPPIA-----VLRVPRPGNPR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14891NP_650560.1 RRM 41..92 CDD:214636
leucine-rich repeat 211..237 CDD:275381 8/42 (19%)
LRR <235..>463 CDD:443914 48/243 (20%)
leucine-rich repeat 239..262 CDD:275381 4/22 (18%)
leucine-rich repeat 263..285 CDD:275381 3/21 (14%)
leucine-rich repeat 286..338 CDD:275381 10/57 (18%)
leucine-rich repeat 339..387 CDD:275381 14/52 (27%)
leucine-rich repeat 388..415 CDD:275381 5/26 (19%)
leucine-rich repeat 416..439 CDD:275381 4/26 (15%)
leucine-rich repeat 440..465 CDD:275381 6/24 (25%)
AT4G30640NP_567849.1 AMN1 <101..>179 CDD:187754 18/110 (16%)
leucine-rich repeat 103..125 CDD:275381 7/45 (16%)
leucine-rich repeat 126..151 CDD:275381 6/31 (19%)
leucine-rich repeat 152..177 CDD:275381 3/24 (13%)
leucine-rich repeat 178..223 CDD:275381 14/53 (26%)
leucine-rich repeat 224..248 CDD:275381 9/54 (17%)
leucine-rich repeat 249..274 CDD:275381 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.