DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14891 and Fbxl17

DIOPT Version :10

Sequence 1:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_056609.1 Gene:Fbxl17 / 50758 MGIID:1354704 Length:701 Species:Mus musculus


Alignment Length:383 Identity:86/383 - (22%)
Similarity:142/383 - (37%) Gaps:120/383 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 WWKVLDYLS----LNERLNFAASCERFQAIYELDSHRINHVLNMKD--VCTLTHR-------VIK 172
            :||.||..|    .:|.|...||  |.|.|.|::   |:...::.|  ||.|..:       ...
Mouse   361 FWKQLDLSSRQQVTDELLEKIAS--RSQNIIEIN---ISDCRSLSDSGVCVLAFKCPGLLRYTAY 420

  Fly   173 RLMLLSGKHI-----HCVTGGPLH-PNWPYLT-EFVQLLGVSCPNLTELSF---FKISVSLAHMT 227
            |...||...|     ||.....:| .|...|| |.::.||..|..|.::.|   :|||       
Mouse   421 RCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSRCRELKDIHFGQCYKIS------- 478

  Fly   228 HLFDGANGLINITNISLRRCNLKDAHIYCLQMLSKLKSLDIRENFSIKGDSLKSL----PISLEI 288
                 ..|:|.|..             .||    ||:.:.::||..:...|:|:.    | .|:.
Mouse   479 -----DEGMIVIAK-------------SCL----KLQRIYMQENKLVTDQSVKAFAEHCP-ELQY 520

  Fly   289 LNVSGCVDLSPKCLIQLAALSHLRELRCPGIVKFAKDNELYGRLAHYCPMLEVLELTDFMNVIQL 353
            :...|| .::.|.:|.|..|.:|..|....|.:.  |||....:...|..|..|.|.        
Mouse   521 VGFMGC-SVTSKGVIHLTKLRNLSSLDLRHITEL--DNETVMEIVKRCKNLSSLNLC-------- 574

  Fly   354 GGLSRLHTLVIHSSAQLDYHVNNVLLTSIAESYSLRHLEILDSFGPMSDTSFDLSIFSQLKELRT 418
                            |::.:|:            |.:|::...|               :.|:.
Mouse   575 ----------------LNWIIND------------RCVEVIAKEG---------------QNLKE 596

  Fly   419 LILHNQNFTTLHLMGLQKLS-TLEFLDLSGSPNLSNE---VVAKLTKSLSGLRRLKVD 472
            |.|.:...|...|:.:.:.| |:|.:|:.....::::   ::|:.:|||..|..::.|
Mouse   597 LYLVSCKITDYALIAIGRYSVTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCD 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14891NP_650560.1 RRM 41..92 CDD:214636
leucine-rich repeat 211..237 CDD:275381 6/28 (21%)
LRR <235..>463 CDD:443914 45/235 (19%)
leucine-rich repeat 239..262 CDD:275381 3/22 (14%)
leucine-rich repeat 263..285 CDD:275381 6/25 (24%)
leucine-rich repeat 286..338 CDD:275381 14/51 (27%)
leucine-rich repeat 339..387 CDD:275381 5/47 (11%)
leucine-rich repeat 388..415 CDD:275381 3/26 (12%)
leucine-rich repeat 416..439 CDD:275381 6/23 (26%)
leucine-rich repeat 440..465 CDD:275381 6/27 (22%)
Fbxl17NP_056609.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..93
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..250
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..321
F-box_FBXO13 320..368 CDD:438864 4/6 (67%)
leucine-rich repeat 362..387 CDD:275381 10/26 (38%)
leucine-rich repeat 388..413 CDD:275381 7/27 (26%)
AMN1 411..573 CDD:187754 47/194 (24%)
leucine-rich repeat 414..439 CDD:275381 6/24 (25%)
leucine-rich repeat 440..465 CDD:275381 8/24 (33%)
leucine-rich repeat 466..491 CDD:275381 10/53 (19%)
leucine-rich repeat 492..517 CDD:275381 6/25 (24%)
leucine-rich repeat 545..567 CDD:275381 6/23 (26%)
leucine-rich repeat 568..593 CDD:275381 8/75 (11%)
leucine-rich repeat 594..618 CDD:275381 6/23 (26%)
leucine-rich repeat 619..644 CDD:275381 3/24 (13%)
leucine-rich repeat 645..670 CDD:275381 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.