DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14891 and Fbxl7

DIOPT Version :10

Sequence 1:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_650512.1 Gene:Fbxl7 / 41935 FlyBaseID:FBgn0038385 Length:772 Species:Drosophila melanogaster


Alignment Length:448 Identity:90/448 - (20%)
Similarity:149/448 - (33%) Gaps:164/448 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 ASTSWHPTPVEESGTLSAYDL--PITDDIWWKVLDYLSLNERLNFAASCERFQ------AIYELD 150
            |:::..|.|....|......|  .:.|:...::..:|...|..|.|..|.||:      .::::.
  Fly   380 AASAIGPPPWNRKGPFRCGPLFDRLPDEAVVRIFSWLDSCELCNVARVCRRFEHLAWRPILWKVI 444

  Fly   151 SHRINHVLNMKDV-----------CTLTHRVIKRLMLLSGKHIHCVTGGPLHPNWPYLTEFVQLL 204
            |.|..|:...|.:           |......::|:||..|..|.              .:.:|||
  Fly   445 SLRGEHLNGDKTLKMIFRQLCGQSCNGACPEVERVMLADGCRIS--------------DKGLQLL 495

  Fly   205 GVSCPNLTELSFFKISVSLAHMTHLFDGANGLINITNISLRRCNLKDAHIYCLQMLSKLKSLDIR 269
            ...||.||.|..                 ...::|||.:|            ::.|:|..     
  Fly   496 TRRCPELTHLQL-----------------QTCVDITNQAL------------VEALTKCS----- 526

  Fly   270 ENFSIKGDSLKSLPISLEILNVSGCVDLSPKCLIQLAALSHLRELRCPGIVKFAKDNELYGRLAH 334
                           :|:.|:|:||..:|     .::...|:...|               ||  
  Fly   527 ---------------NLQHLDVTGCSQVS-----SISPNPHMEPPR---------------RL-- 554

  Fly   335 YCPMLEVLELTDFMNVIQLGGLSRLHTLVIHSSAQLDYHVNNVLLTSIAESYSLRHLEILDS--- 396
               :|:.|:|||.|.:..:|     ..:|:.:..||.|            .|..|.:::.|:   
  Fly   555 ---LLQYLDLTDCMAIDDMG-----LKIVVKNCPQLVY------------LYLRRCIQVTDAGLK 599

  Fly   397 FGPMSDTSFDLSIFSQLKELRTLILHNQNFTTLHLMGLQKLST---------------------- 439
            |.|    ||.:|    ||||.  :....|.|...|..|.||..                      
  Fly   600 FVP----SFCVS----LKELS--VSDCLNITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIA 654

  Fly   440 -----LEFLDLSGSPNLSNEVVAKLTKSLSGLRRLKVDFCPLITRQLTKILEGNPKLQ 492
                 |.:|:..|...:|::.:..|.:|...||.|.:..|.:....|..:.|..|.|:
  Fly   655 RRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCDVSDAGLRALAESCPNLK 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14891NP_650560.1 RRM 41..92 CDD:214636
leucine-rich repeat 211..237 CDD:275381 3/25 (12%)
LRR <235..>463 CDD:443914 50/257 (19%)
leucine-rich repeat 239..262 CDD:275381 5/22 (23%)
leucine-rich repeat 263..285 CDD:275381 0/21 (0%)
leucine-rich repeat 286..338 CDD:275381 10/51 (20%)
leucine-rich repeat 339..387 CDD:275381 11/47 (23%)
leucine-rich repeat 388..415 CDD:275381 8/29 (28%)
leucine-rich repeat 416..439 CDD:275381 7/22 (32%)
leucine-rich repeat 440..465 CDD:275381 6/24 (25%)
Fbxl7NP_650512.1 leucine-rich repeat 502..521 CDD:275381 7/47 (15%)
leucine-rich repeat 528..555 CDD:275381 10/51 (20%)
leucine-rich repeat 556..581 CDD:275381 8/29 (28%)
AMN1 577..746 CDD:187754 35/158 (22%)
leucine-rich repeat 582..607 CDD:275381 9/40 (23%)
leucine-rich repeat 608..633 CDD:275381 10/26 (38%)
leucine-rich repeat 634..659 CDD:275381 0/24 (0%)
leucine-rich repeat 660..685 CDD:275381 6/24 (25%)
leucine-rich repeat 686..710 CDD:275381 6/23 (26%)
leucine-rich repeat 711..735 CDD:275381 1/2 (50%)
leucine-rich repeat 737..761 CDD:275381
dermokine <279..>394 CDD:455732 3/13 (23%)
F-box_SF 401..444 CDD:459239 8/42 (19%)
leucine-rich repeat 441..460 CDD:275381 4/18 (22%)
leucine-rich repeat 476..501 CDD:275381 9/38 (24%)
LRR <483..>640 CDD:443914 55/271 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.