DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14891 and fbxl2

DIOPT Version :10

Sequence 1:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_956400.1 Gene:fbxl2 / 378737 ZFINID:ZDB-GENE-030925-12 Length:432 Species:Danio rerio


Alignment Length:390 Identity:95/390 - (24%)
Similarity:154/390 - (39%) Gaps:86/390 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 RFQAIYELDSHRIN---------HVLNMKDVCTLTH--RVIK--RLMLLSGKHIHCVTGGPLHPN 193
            ||:.....|...||         .:.:..||.||..  :|.|  .::.|.|.            |
Zfish     8 RFEVFSNNDEAPINKKLPKELLLRIFSYLDVVTLCRCAQVSKAWNVLALDGS------------N 60

  Fly   194 WPYLTEF----------VQLLGVSCPN-LTELSFFK-ISVSLAHMTHLFDGANGLINITNISLRR 246
            |..:..|          |:.:...|.. |.:||... :||..|.|...   |....||.:::|..
Zfish    61 WQKIDLFNFQTDIEGRVVENISKRCGGFLRQLSLRGCLSVGDASMKTF---AQNCRNIEHLNLNG 122

  Fly   247 CNLKDAHIYCLQMLS---KLKSLDIRENFSIKGDSLKSLPIS---LEILNVSGCVDLSPKCLIQL 305
            |. |.....|:.:..   ||:.||:....||...:||:|...   ||.||:|.|..::..   .:
Zfish   123 CT-KITDSTCISLSKFCFKLRHLDLTSCVSITNHALKALSEGCRMLENLNLSWCDQITSD---GI 183

  Fly   306 AALSH----LRELRCPGIVKFAKDNELYGRLAHYCPMLEVL------ELTDFMNVIQLGGLSRLH 360
            .|||.    ||.|...|..:.  |:.....|..:||.|..:      ::||...|....|..:|.
Zfish   184 EALSRGCTALRALFLRGCTQL--DDTALKHLQKHCPELMTINMQSCTQITDDGFVSLCRGCHKLQ 246

  Fly   361 TLVIHSSAQLDYHVNNVLLTSIAESYSLRHLEILDS--FGPMSDTSFDLSIFS----QLKELRTL 419
            .:.|...:    ::.:..||::  ..:.:.|:||::  ...::|..|.:...:    :..:|...
Zfish   247 MVCISGCS----NITDASLTAL--GLNCQRLKILEAARCSHVTDAGFTVLARNCHEMEKMDLEEC 305

  Fly   420 ILHNQNF---TTLHLMGLQKLSTLEFLDLSGSPNLSNEVVAKLTKSLSGLRRLKV---DFCPLIT 478
            ||...|.   .::|...||.||      ||....::::.:..|:.|:.|..||:|   |.|||||
Zfish   306 ILVTDNTLVQLSIHCPRLQALS------LSHCELITDDGIRHLSSSVCGQERLQVVELDNCPLIT 364

  Fly   479  478
            Zfish   365  364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14891NP_650560.1 RRM 41..92 CDD:214636
leucine-rich repeat 211..237 CDD:275381 8/26 (31%)
LRR <235..>463 CDD:443914 58/252 (23%)
leucine-rich repeat 239..262 CDD:275381 5/25 (20%)
leucine-rich repeat 263..285 CDD:275381 8/21 (38%)
leucine-rich repeat 286..338 CDD:275381 16/55 (29%)
leucine-rich repeat 339..387 CDD:275381 9/53 (17%)
leucine-rich repeat 388..415 CDD:275381 5/32 (16%)
leucine-rich repeat 416..439 CDD:275381 8/25 (32%)
leucine-rich repeat 440..465 CDD:275381 4/24 (17%)
fbxl2NP_956400.1 F-box_FBXL2-like 18..62 CDD:438887 11/55 (20%)
leucine-rich repeat 61..88 CDD:275381 4/26 (15%)
AMN1 63..284 CDD:187754 55/235 (23%)
leucine-rich repeat 89..108 CDD:275381 7/18 (39%)
leucine-rich repeat 115..140 CDD:275381 5/25 (20%)
leucine-rich repeat 141..166 CDD:275381 8/24 (33%)
leucine-rich repeat 167..192 CDD:275381 9/27 (33%)
leucine-rich repeat 193..218 CDD:275381 7/26 (27%)
AMN1 212..390 CDD:187754 40/165 (24%)
leucine-rich repeat 219..244 CDD:275381 5/24 (21%)
leucine-rich repeat 245..270 CDD:275381 4/30 (13%)
leucine-rich repeat 271..296 CDD:275381 5/24 (21%)
leucine-rich repeat 297..322 CDD:275381 5/24 (21%)
leucine-rich repeat 323..351 CDD:275381 9/33 (27%)
leucine-rich repeat 352..376 CDD:275381 8/13 (62%)
leucine-rich repeat 377..402 CDD:275381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.