DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14891 and CG9003

DIOPT Version :10

Sequence 1:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster


Alignment Length:500 Identity:111/500 - (22%)
Similarity:187/500 - (37%) Gaps:139/500 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DREVVRQLTISGSRRFLKYQLLKYFSIFGKVEKLHWKKKKRSGSVLFYEATHAAKALYCTKHTID 86
            |.|:::||.        |..||:.||....|......:..:..:||                .:|
  Fly   236 DDELIKQLP--------KEVLLRVFSYLDVVSLCRCAQVCKYWNVL----------------ALD 276

  Fly    87 GHDLYLQASTSWHPTPVEESGTLSAYDL------PITDDIWWKVLDYL-SLNERLNFAASCERF- 143
            |        :||.        .::.:|.      |:.::|..:...:| ||:.|     .|:.. 
  Fly   277 G--------SSWQ--------KINLFDFQRDIEGPVIENISQRCRGFLKSLSLR-----GCQSVG 320

  Fly   144 -QAIYELDS--HRINHVLNMKDVCTLTHRVIKRLMLLSGKHI--HC--VTGGPLHPNWPYLTEFV 201
             |::..|.:  |.|.| |::.| |       |::..:|.:.|  :|  :|...||.........:
  Fly   321 DQSVRTLANHCHNIEH-LDLSD-C-------KKITDISTQSISRYCSKLTAINLHSCSNITDNSL 376

  Fly   202 QLLGVSCPNLTELSFFKISVSLAHMTHLFDG----ANGLINITNISLRRC-NLKDAHIYCL-QML 260
            :.|...||||.|     |:||..|:.. .:|    |.|.:.:...|.:.| .:.|..|.|| :..
  Fly   377 KYLSDGCPNLME-----INVSWCHLIS-ENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYC 435

  Fly   261 SKLKSLDIRENFSIKGDSLKSLPIS---LEILNVSGCVDLSPKCLIQLAALSH-LRELRCPGIVK 321
            ..|..|::....:|...|::.|..:   |:.|.||.|.||:...|:.|:..:| |..|...|...
  Fly   436 PDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRN 500

  Fly   322 FAKDNELYGRLAHYCPMLEVLELTDFMNVIQLGGLSRLHTLVIHSSAQLDYHVNNVLLTSI--AE 384
            |....  :..|...|..||.::|.:   ..|:..|:..|                 |.|..  .|
  Fly   501 FTDIG--FQALGRNCKYLERMDLEE---CSQITDLTLAH-----------------LATGCPSLE 543

  Fly   385 SYSLRHLEILDSFGPMSDTSFDLSIFSQLKELRTLILHNQNFTTLHLMGLQKLSTLEFLDLSGSP 449
            ..:|.|.|::...|              ::.|.|              |......|..|:|...|
  Fly   544 KLTLSHCELITDDG--------------IRHLTT--------------GSCAAEILSVLELDNCP 580

  Fly   450 NLSNEVVAKLTKSLSGLRRLKVDFCPLITRQLTKILEGN-PKLQV 493
            .:::..:..|. |...|:|:::..|.||||...:.|:.: |.::|
  Fly   581 LITDRTLEHLV-SCHNLQRIELFDCQLITRTAIRKLKNHLPNIKV 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14891NP_650560.1 RRM 41..92 CDD:214636 9/50 (18%)
leucine-rich repeat 211..237 CDD:275381 9/29 (31%)
LRR <235..>463 CDD:443914 49/235 (21%)
leucine-rich repeat 239..262 CDD:275381 6/24 (25%)
leucine-rich repeat 263..285 CDD:275381 5/21 (24%)
leucine-rich repeat 286..338 CDD:275381 16/52 (31%)
leucine-rich repeat 339..387 CDD:275381 9/49 (18%)
leucine-rich repeat 388..415 CDD:275381 4/26 (15%)
leucine-rich repeat 416..439 CDD:275381 3/22 (14%)
leucine-rich repeat 440..465 CDD:275381 6/24 (25%)
CG9003NP_001097271.1 F-box_FBXL2-like 237..281 CDD:438887 14/75 (19%)
leucine-rich repeat 280..307 CDD:275381 4/34 (12%)
AMN1 <308..453 CDD:187754 42/164 (26%)
leucine-rich repeat 308..327 CDD:275381 6/23 (26%)
leucine-rich repeat 334..359 CDD:275381 9/33 (27%)
leucine-rich repeat 360..385 CDD:275381 5/24 (21%)
leucine-rich repeat 386..411 CDD:275381 9/30 (30%)
AMN1 <409..586 CDD:187754 47/226 (21%)
leucine-rich repeat 412..437 CDD:275381 6/24 (25%)
leucine-rich repeat 438..463 CDD:275381 5/24 (21%)
leucine-rich repeat 464..515 CDD:275381 16/52 (31%)
leucine-rich repeat 516..541 CDD:275381 8/44 (18%)
leucine-rich repeat 542..561 CDD:275381 5/32 (16%)
leucine-rich repeat 571..595 CDD:275381 6/24 (25%)
leucine-rich repeat 596..621 CDD:275381 8/24 (33%)

Return to query results.
Submit another query.