DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14891 and Fbxl15

DIOPT Version :10

Sequence 1:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001101073.1 Gene:Fbxl15 / 309453 RGDID:1306444 Length:300 Species:Rattus norvegicus


Alignment Length:327 Identity:75/327 - (22%)
Similarity:120/327 - (36%) Gaps:85/327 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PVEES------GTLSAYDLPITDDIWWKVLDYLSLNERLNFAASCERFQAIYELDSHRINHVLNM 160
            |:|:|      |.:...|||..|.:...||:::.|.:.|........|:|:.:|...|:.. .:.
  Rat     4 PMEQSGGEQEPGAVRLLDLPWEDVLLPHVLNWVPLRQLLRLQRVSRAFRALVQLHLARLRR-FDA 67

  Fly   161 KDVCTLTHRVIKRLMLLSGKHIHCVTGGPLHPNW-------PYLTEFVQLLGVS----------- 207
            ..|.....|.....:|...:.:..:...|.| .|       |.|....||..|:           
  Rat    68 AQVGPQIPRAALVRLLRDAEGLQELALAPCH-EWLLDEDLVPVLARNPQLRSVALAGCGQLSRRA 131

  Fly   208 -------CPNLTELSFFKISVSLAHMTHLFDG--ANGLIN----ITNISLRRC-NLKD-AHIYCL 257
                   ||.|..       :||||...: ||  ..||.:    :..:.|..| .||| |.:|..
  Rat   132 LGALAEGCPRLQR-------ISLAHCDWV-DGLALRGLADRCPALEELDLTACRQLKDEAIVYLA 188

  Fly   258 QML-SKLKSLDIRENFSIKGDS-----LKSLPISLEILNVSGCVDLSPKCLIQLAALSHLRELRC 316
            |.. :.|:||.:..|.:: ||:     .::.| .||.|:::||:.:.                  
  Rat   189 QRRGAGLRSLSLAVNANV-GDTAVQELARNCP-QLEHLDLTGCLRVG------------------ 233

  Fly   317 PGIVKFAKDNELYGRLAHYCPMLEVLELTDFMNVIQLGGLSRLHTLVIHSSAQLDYHVNNVLLTS 381
                     ::....||.|||.|..|.:....:|.: ..||||....:....:...|...|||..
  Rat   234 ---------SDGVRTLAEYCPALRSLRVRHCHHVAE-PSLSRLRKRGVDIDVEPPLHQALVLLQD 288

  Fly   382 IA 383
            :|
  Rat   289 MA 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14891NP_650560.1 RRM 41..92 CDD:214636
leucine-rich repeat 211..237 CDD:275381 8/27 (30%)
LRR <235..>463 CDD:443914 39/161 (24%)
leucine-rich repeat 239..262 CDD:275381 8/25 (32%)
leucine-rich repeat 263..285 CDD:275381 7/26 (27%)
leucine-rich repeat 286..338 CDD:275381 9/51 (18%)
leucine-rich repeat 339..387 CDD:275381 12/45 (27%)
leucine-rich repeat 388..415 CDD:275381
leucine-rich repeat 416..439 CDD:275381
leucine-rich repeat 440..465 CDD:275381
Fbxl15NP_001101073.1 F-box_FBXL15 19..62 CDD:438898 11/42 (26%)
leucine-rich repeat 62..88 CDD:275381 3/26 (12%)
FBXL3_LRR-like <71..146 CDD:480268 13/82 (16%)
leucine-rich repeat 89..115 CDD:275381 5/26 (19%)
Interaction with SMURF1. /evidence=ECO:0000250 113..269 46/193 (24%)
leucine-rich repeat 116..141 CDD:275381 3/24 (13%)
AMN1 <139..>268 CDD:187754 43/166 (26%)
leucine-rich repeat 142..167 CDD:275381 9/32 (28%)
leucine-rich repeat 168..194 CDD:275381 8/25 (32%)
leucine-rich repeat 195..220 CDD:275381 7/26 (27%)
leucine-rich repeat 221..245 CDD:275381 8/50 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.