DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14891 and Fbxl21

DIOPT Version :10

Sequence 1:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_038951543.1 Gene:Fbxl21 / 306750 RGDID:1305555 Length:460 Species:Rattus norvegicus


Alignment Length:178 Identity:41/178 - (23%)
Similarity:68/178 - (38%) Gaps:48/178 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 LIQLAALSHLRELRCPGIVKFAKDNELYGRLAHYCPMLEVLELTDFMNVIQLGGLSRLHTLVIHS 366
            |||.....|...|:   .|.|..|:......| .|.:|.           ||...| :.||.:.|
  Rat   130 LIQQIIKKHAAHLQ---YVSFKVDSSTESAEA-ACHILS-----------QLVNCS-IQTLGLIS 178

  Fly   367 SAQLDY------HVNNVLLTSIAESYSLRHLEILDSFGPMSDTSFDLSIFSQLKELRTLILHNQN 425
            :|:..:      |..:.|......|.||..::|.|:  |:.|.|           |:.|:.:|.:
  Rat   179 TAKPSFMNMPKSHFVSALTVVFVNSKSLSSIKIEDT--PVDDPS-----------LKILVANNSD 230

  Fly   426 FTTLHLMGLQKLSTLEFLDLSGSPNLSNEVVAKLTKSLSGLRRLKVDF 473
                         ||..|.:|..|::|::.:..:.....|||.|.:::
  Rat   231 -------------TLRLLKMSSCPHVSSDGILCVADHCQGLRELALNY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14891NP_650560.1 RRM 41..92 CDD:214636
leucine-rich repeat 211..237 CDD:275381
LRR <235..>463 CDD:443914 37/166 (22%)
leucine-rich repeat 239..262 CDD:275381
leucine-rich repeat 263..285 CDD:275381
leucine-rich repeat 286..338 CDD:275381 10/35 (29%)
leucine-rich repeat 339..387 CDD:275381 11/53 (21%)
leucine-rich repeat 388..415 CDD:275381 6/26 (23%)
leucine-rich repeat 416..439 CDD:275381 3/22 (14%)
leucine-rich repeat 440..465 CDD:275381 5/24 (21%)
Fbxl21XP_038951543.1 F-box_SF 66..108 CDD:459239
FBXL21_LRR 111..460 CDD:467831 41/178 (23%)
leucine-rich repeat 206..231 CDD:275381 9/50 (18%)
leucine-rich repeat 232..257 CDD:275381 5/24 (21%)
leucine-rich repeat 258..283 CDD:275381 3/8 (38%)
leucine-rich repeat 284..318 CDD:275381
leucine-rich repeat 329..365 CDD:275381
leucine-rich repeat 366..392 CDD:275381
leucine-rich repeat 393..418 CDD:275381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.