DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14891 and FBXL2

DIOPT Version :10

Sequence 1:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster
Sequence 2:XP_054201991.1 Gene:FBXL2 / 25827 HGNCID:13598 Length:479 Species:Homo sapiens


Alignment Length:300 Identity:77/300 - (25%)
Similarity:122/300 - (40%) Gaps:61/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 NITNISLRRC-NLKDAHIYCL-QMLSKLKSLDIRENFSIKGDSLKSLP---ISLEILNVSGCVDL 297
            ||.:::|..| .:.|:..|.| :..||||.||:....||...|||.:.   .:||.||:|.|..:
Human   130 NIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQI 194

  Fly   298 SPKCLIQLA-ALSHLRELRCPGIVKFAKDNELYGRLAHYCPMLEVLEL------TDFMNVIQL-G 354
            :...:..|. ....|:.|...|..:.  ::|....:.:||..|..|.|      || ..|:|: .
Human   195 TKDGIEALVRGCRGLKALLLRGCTQL--EDEALKHIQNYCHELVSLNLQSCSRITD-EGVVQICR 256

  Fly   355 GLSRLHTLVIHSSAQLDYHVNNVLLTSIAESYSLRHLEILDS--FGPMSDTSFDLSIFSQLKELR 417
            |..||..|.:...:.|    .:..||::  ..:...|:||::  ...::|..|.| :.....||.
Human   257 GCHRLQALCLSGCSNL----TDASLTAL--GLNCPRLQILEAARCSHLTDAGFTL-LARNCHELE 314

  Fly   418 TLILHNQNFTT--------LHLMGLQKLSTLEFLD-------------------------LSGSP 449
            .:.|......|        :|...||.|.:|.|.|                         ||...
Human   315 KMDLEECILITDSTLIQLSIHCPKLQALVSLSFSDIIHLLKMKEPSHHNKKLFGFSFCKSLSHCE 379

  Fly   450 NLSNEVVAKLTKSLSG---LRRLKVDFCPLITRQLTKILE 486
            .::::.:..|:.|..|   ||.|::|.|.|||....:.||
Human   380 LITDDGILHLSNSTCGHERLRVLELDNCLLITDVALEHLE 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14891NP_650560.1 RRM 41..92 CDD:214636
leucine-rich repeat 211..237 CDD:275381
LRR <235..>463 CDD:443914 65/272 (24%)
leucine-rich repeat 239..262 CDD:275381 6/24 (25%)
leucine-rich repeat 263..285 CDD:275381 9/24 (38%)
leucine-rich repeat 286..338 CDD:275381 13/52 (25%)
leucine-rich repeat 339..387 CDD:275381 14/54 (26%)
leucine-rich repeat 388..415 CDD:275381 6/28 (21%)
leucine-rich repeat 416..439 CDD:275381 7/30 (23%)
leucine-rich repeat 440..465 CDD:275381 7/49 (14%)
FBXL2XP_054201991.1 F-box_FBXL2-like 34..78 CDD:438887
leucine-rich repeat 77..104 CDD:275381
AMN1 <101..248 CDD:187754 34/119 (29%)
leucine-rich repeat 105..124 CDD:275381
leucine-rich repeat 131..156 CDD:275381 6/24 (25%)
leucine-rich repeat 157..182 CDD:275381 9/24 (38%)
leucine-rich repeat 183..208 CDD:275381 7/24 (29%)
AMN1 193..423 CDD:187754 52/236 (22%)
leucine-rich repeat 209..234 CDD:275381 6/26 (23%)
leucine-rich repeat 235..260 CDD:275381 8/25 (32%)
leucine-rich repeat 261..286 CDD:275381 5/30 (17%)
leucine-rich repeat 287..312 CDD:275381 6/25 (24%)
leucine-rich repeat 313..338 CDD:275381 4/24 (17%)
leucine-rich repeat 339..389 CDD:275381 8/49 (16%)
leucine-rich repeat 399..418 CDD:275381 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.