| Sequence 1: | NP_650560.1 | Gene: | CG14891 / 42013 | FlyBaseID: | FBgn0038445 | Length: | 495 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001408690.1 | Gene: | Fbxl19 / 233902 | MGIID: | 3039600 | Length: | 696 | Species: | Mus musculus |
| Alignment Length: | 136 | Identity: | 33/136 - (24%) |
|---|---|---|---|
| Similarity: | 48/136 - (35%) | Gaps: | 40/136 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 201 VQLLGVSCPNLTELSFFKISVSLAHMTHLFDGANGLINITNISLR----RCNLKDAH---IYCLQ 258
Fly 259 ML---SKLKSLDIRENFSIKGDSLKSLPISLEILNVSGCVDLSPKCLIQLAALSHLRELRCPGIV 320
Fly 321 KFAKDN 326 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG14891 | NP_650560.1 | RRM | 41..92 | CDD:214636 | |
| leucine-rich repeat | 211..237 | CDD:275381 | 6/25 (24%) | ||
| LRR | <235..>463 | CDD:443914 | 24/102 (24%) | ||
| leucine-rich repeat | 239..262 | CDD:275381 | 7/32 (22%) | ||
| leucine-rich repeat | 263..285 | CDD:275381 | 4/21 (19%) | ||
| leucine-rich repeat | 286..338 | CDD:275381 | 12/41 (29%) | ||
| leucine-rich repeat | 339..387 | CDD:275381 | |||
| leucine-rich repeat | 388..415 | CDD:275381 | |||
| leucine-rich repeat | 416..439 | CDD:275381 | |||
| leucine-rich repeat | 440..465 | CDD:275381 | |||
| Fbxl19 | NP_001408690.1 | zf-CXXC | <52..79 | CDD:366873 | |
| PHD_FXL19 | 89..150 | CDD:277115 | |||
| F-box_JHDM | 423..465 | CDD:438894 | |||
| AMN1 | 468..667 | CDD:187754 | 22/105 (21%) | ||
| leucine-rich repeat | 488..511 | CDD:275381 | |||
| leucine-rich repeat | 512..535 | CDD:275381 | |||
| leucine-rich repeat | 573..600 | CDD:275381 | 2/8 (25%) | ||
| leucine-rich repeat | 601..627 | CDD:275381 | 7/32 (22%) | ||
| leucine-rich repeat | 631..655 | CDD:275381 | 5/23 (22%) | ||
| leucine-rich repeat | 656..680 | CDD:275381 | 11/46 (24%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||