DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14891 and Fbxl18

DIOPT Version :10

Sequence 1:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster
Sequence 2:NP_001028484.2 Gene:Fbxl18 / 231863 MGIID:2444450 Length:707 Species:Mus musculus


Alignment Length:439 Identity:95/439 - (21%)
Similarity:172/439 - (39%) Gaps:106/439 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 EESGTLSAYD---LPITDDIWWKVLDYL-SLNERLNFAASCERFQAIYELDSHRINHVLNMKDVC 164
            ||:...:|.|   |..:|:|...:|.:: |.:..|:...:|.:..|:. ||...::.||..||. 
Mouse     5 EEAAAEAAGDTHLLGFSDEILLHILSHVPSTDLVLSVRRTCRKLAALC-LDKSLVHTVLLQKDY- 67

  Fly   165 TLTHRVIKRLMLLSGKHI--------HCVTGGPLHPNWPYLTEFVQLLGVS---CPNLTELSFFK 218
            ..:...:|:|:...|:.|        :.::|..:.    ::.....|:.|:   | :||.|...|
Mouse    68 QASEEKVKQLVKEIGREIQQLNMAGCYWLSGSTIE----HVARCHSLVKVNLSGC-HLTSLRLSK 127

  Fly   219 ISVSLAHMTHL-------FDGANGLINITNISLRRCNLKDAHIYCLQMLSKLKSLDIRENFSIKG 276
            :..:|.|:..|       || |:.|.:....:|.|             :.:||......::.:..
Mouse   128 VLSALQHLRSLAIDVSPGFD-ASQLSSECKATLSR-------------VQELKQTLFTPSYGVVP 178

  Fly   277 --DSLKSLPISLEILNVS--GCVDLSPKCLIQLAALSHLRELRCPGIVKFAKDNELYGRLAHYCP 337
              .||:.|.:..|||:.:  |.| ||.:.::..:.:.|.:.||.           .|.|||....
Mouse   179 CCASLQKLLLYFEILDRTREGAV-LSGQLMVGQSNVPHYQNLRV-----------FYARLAPGYI 231

  Fly   338 MLEVLELTDFMNVIQLGGLSRLHTLVI-------HSSAQ---LDYHVNNVLLTSIA-------ES 385
            ..||:.|  ::.|:.......||..:|       .|.|.   ||....||.|.::.       .|
Mouse   232 NQEVVRL--YLAVLSDRTPENLHAFLISVPGSFAESGATKNLLDSMARNVALDALQLPKSWLNGS 294

  Fly   386 YSLRHLEILDSFGPMSDTSFDLS---IFSQL----KELRTLILHNQNFTTLHLMGLQKLSTLEFL 443
            ..|:|::..:.| ..|.:...||   :..:|    |:||:|       .:|:|.|.....:.:.|
Mouse   295 TLLQHMKFNNPF-YFSFSRCTLSGGHLIQRLINGGKDLRSL-------ASLNLSGCVHCLSADSL 351

  Fly   444 DLSGSPNLSNEVVAKLTKSLSGLRRLKVD-------------FCPLITR 479
            ......::.:.::..|.:|...|..|.:.             .|.|:.|
Mouse   352 LRKAEDDIDSSILETLVESCCNLHHLNLSAAHHHSSDGLGRHLCQLLAR 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14891NP_650560.1 RRM 41..92 CDD:214636
leucine-rich repeat 211..237 CDD:275381 10/32 (31%)
LRR <235..>463 CDD:443914 53/255 (21%)
leucine-rich repeat 239..262 CDD:275381 2/22 (9%)
leucine-rich repeat 263..285 CDD:275381 5/23 (22%)
leucine-rich repeat 286..338 CDD:275381 14/53 (26%)
leucine-rich repeat 339..387 CDD:275381 15/64 (23%)
leucine-rich repeat 388..415 CDD:275381 7/33 (21%)
leucine-rich repeat 416..439 CDD:275381 6/22 (27%)
leucine-rich repeat 440..465 CDD:275381 3/24 (13%)
Fbxl18NP_001028484.2 F-box_SF 17..60 CDD:459239 10/43 (23%)
FBXL18_LRR 74..664 CDD:466163 77/368 (21%)
leucine-rich repeat 85..109 CDD:275381 2/27 (7%)
leucine-rich repeat 110..131 CDD:275381 7/21 (33%)
leucine-rich repeat 308..330 CDD:275381 4/21 (19%)
leucine-rich repeat 331..373 CDD:275381 9/48 (19%)
leucine-rich repeat 374..403 CDD:275381 5/27 (19%)
leucine-rich repeat 404..473 CDD:275381
leucine-rich repeat 522..548 CDD:275381
leucine-rich repeat 549..578 CDD:275381
leucine-rich repeat 579..604 CDD:275381
leucine-rich repeat 605..629 CDD:275381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.