DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEA1 and CG14341

DIOPT Version :9

Sequence 1:NP_001350507.1 Gene:MEA1 / 4201 HGNCID:6986 Length:188 Species:Homo sapiens
Sequence 2:NP_608580.2 Gene:CG14341 / 33301 FlyBaseID:FBgn0031315 Length:180 Species:Drosophila melanogaster


Alignment Length:140 Identity:34/140 - (24%)
Similarity:53/140 - (37%) Gaps:18/140 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    60 EQEETGSGPAGYSYQPLNQDPEQ-----EEV---ELAPVGDGDVVADIQDRIQALGLHLPDP--- 113
            |.|:.....|...||||..|.|.     ||:   :..|..|.|...|:.......|    ||   
  Fly    28 ESEDDDDSDAYDGYQPLALDEENDAADPEEMSREQETPSADNDEDVDLMTAPVTHG----DPNMP 88

Human   114 ---PLESEDEDEEGATALNNHSSIPMDPEHVELVKRTMAGVSLPAPGVPAWAREISDAQWEDVVQ 175
               |.:.|.|.:..:........:.:|....|.:.:.|:.::||...||.|||.:.:..|:..:.
  Fly    89 AIEPADVEIERQVWSEPRPRELQMDLDKTRTEQILKAMSTITLPNITVPDWARGVPEEHWKHELL 153

Human   176 KALQARQASP 185
            ..:..|...|
  Fly   154 DRINNRHHPP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEA1NP_001350507.1 MEA1 69..184 CDD:369132 31/128 (24%)
CG14341NP_608580.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155222
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1638941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR17005
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.