DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEA1 and CG14341

DIOPT Version :10

Sequence 1:NP_001350507.1 Gene:MEA1 / 4201 HGNCID:6986 Length:188 Species:Homo sapiens
Sequence 2:NP_608580.2 Gene:CG14341 / 33301 FlyBaseID:FBgn0031315 Length:180 Species:Drosophila melanogaster


Alignment Length:64 Identity:13/64 - (20%)
Similarity:23/64 - (35%) Gaps:17/64 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    33 PYSHRARLVLKAKGIRHEVININLKSKPDWYYTK----------------HPFGQIPVLENSQC 80
            |.|..:.||..::..|.: .::.|||...:.:.:                .||..||.:....|
  Fly   752 PLSEGSFLVRNSESTRQD-YSLTLKSAKGFMHMRIQRDADSGQFILGQFSRPFPTIPDMIRHFC 814

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEA1NP_001350507.1 MEA1 69..184 CDD:429188 4/12 (33%)
CG14341NP_608580.2 MEA1 37..159 CDD:429188
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.