DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and CASP9

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_011540575.1 Gene:CASP9 / 842 HGNCID:1511 Length:421 Species:Homo sapiens


Alignment Length:258 Identity:79/258 - (30%)
Similarity:120/258 - (46%) Gaps:43/258 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DLKRIIISRPTNEDTYENCARAGIALILNHKDV---KGQKQRVGTERDRDDMEATLQGFGFDVRT 95
            ||..|:...|           .|..||:|:.:.   .|.:.|.|:..|.:.:........|.|..
Human   150 DLAYILSMEP-----------CGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFMVEV 203

  Fly    96 FDDLTFSEINDTLKEVAREDHSQNDCFVLAVMSHGTE-------GKVYAKD-MSYPVERLWNPFL 152
            ..|||..::...|.|:|::||...||.|:.::|||.:       |.||..| ....||::.|.|.
Human   204 KGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAVYGTDGCPVSVEKIVNIFN 268

  Fly   153 GDNCKTLKNKPKLFFIQACRGANLEKAVEFSSFAVMTRE--LVPEPAAA-----------VQPIT 204
            |.:|.:|..||||||||||.|...:...|.:|.:.....  ..|||.|.           :..|:
Human   269 GTSCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDESPGSNPEPDATPFQEGLRTFDQLDAIS 333

  Fly   205 YAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVN 267
             ::|:.:||.|.||||..|.|:|:...|||::::|..:.:|.|.:|       :|..||..|:
Human   334 -SLPTPSDIFVSYSTFPGFVSWRDPKSGSWYVETLDDIFEQWAHSE-------DLQSLLLRVS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 75/238 (32%)
CASP9XP_011540575.1 CARD_CASP9 17..90 CDD:176740
CASc 152..397 CDD:237997 77/256 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152749
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.700

Return to query results.
Submit another query.