DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and CASP8

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001073594.1 Gene:CASP8 / 841 HGNCID:1509 Length:538 Species:Homo sapiens


Alignment Length:264 Identity:84/264 - (31%)
Similarity:130/264 - (49%) Gaps:38/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GIALILNHKDVKGQKQRV----------GTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKE 110
            |..||:|:.:....:::|          ||..|...:..|.:...|:::..||.|..:|.:.||.
Human   293 GYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKI 357

  Fly   111 VAREDHSQNDCFVLAVMSHGTEGKVYAKD-MSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGA 174
            ....|||..|||:..::|||.:|.:|..| ...|:..|.:.|.|..|.:|..|||:||||||:|.
Human   358 YQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGD 422

  Fly   175 NLEKAVEFSSFAVMTRELVPEPAAAV---QPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFI 236
            |.:|.:...:      :...:|...:   .|.|..||..||.|:..:|.:...|:||..:|:|:|
Human   423 NYQKGIPVET------DSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYI 481

  Fly   237 QSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTKTFQ 301
            ||||:.|.:..      |.|.::|.:||.||      |:.:.|::..|..|:||.      .||.
Human   482 QSLCQSLRERC------PRGDDILTILTEVN------YEVSNKDDKKNMGKQMPQ------PTFT 528

  Fly   302 LRVK 305
            ||.|
Human   529 LRKK 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 81/259 (31%)
CASP8NP_001073594.1 DED_Caspase_8_r1 62..143 CDD:260041
DD 157..239 CDD:301326
CASc 284..536 CDD:237997 84/264 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152735
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.700

Return to query results.
Submit another query.