DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and CASP4

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001216.1 Gene:CASP4 / 837 HGNCID:1505 Length:377 Species:Homo sapiens


Alignment Length:246 Identity:69/246 - (28%)
Similarity:104/246 - (42%) Gaps:44/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DKADATKIAHTPTSELDLKRIIISRPTNEDTY---ENCARAGIALILNHKDVKGQKQRVGTERDR 79
            :..||.|:.  |..|.    :.:.:...|:.|   |...|..:|||:.:.:......|.|.:.|.
Human   101 ESTDALKLC--PHEEF----LRLCKERAEEIYPIKERNNRTRLALIICNTEFDHLPPRNGADFDI 159

  Fly    80 DDMEATLQGFGFDVRTFDDLTFSEINDTLKEVA-REDHSQNDCFVLAVMSHGTE----GKVYAKD 139
            ..|:..|:|..:.|...::||..::...|:..| |.:|..:|...|.:||||..    |.|:  |
Human   160 TGMKELLEGLDYSVDVEENLTARDMESALRAFATRPEHKSSDSTFLVLMSHGILEGICGTVH--D 222

  Fly   140 MSYP----VERLWNPFLGDNCKTLKNKPKLFFIQACRGAN------------LEKAVEFSSFAVM 188
            ...|    .:.::..|...||.:||:|||:..:|||||||            ||.|...||    
Human   223 EKKPDVLLYDTIFQIFNNRNCLSLKDKPKVIIVQACRGANRGELWVRDSPASLEVASSQSS---- 283

  Fly   189 TRELVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSL 239
              |.:.|.|      .|......|.:.|.|:.....|:|:...||.||..|
Human   284 --ENLEEDA------VYKTHVEKDFIAFCSSTPHNVSWRDSTMGSIFITQL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 61/207 (29%)
CASP4NP_001216.1 Required for LPS-binding. /evidence=ECO:0000250|UniProtKB:P70343 1..59
CARD_CASP1-like 5..81 CDD:260036
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 0/2 (0%)
CASc 126..375 CDD:214521 63/215 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152727
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.