DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and XB5812047

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_031753853.1 Gene:XB5812047 / 733553 XenbaseID:XB-GENE-5812048 Length:244 Species:Xenopus tropicalis


Alignment Length:253 Identity:70/253 - (27%)
Similarity:117/253 - (46%) Gaps:34/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GIALIL-------NHKDVKGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAR 113
            |.|:|:       .|.:|....||.|.:||.:.:...|...|:.|....|::..||.|..::.::
 Frog     8 GRAVIIAISEFHPRHGEVGSLDQRKGVKRDVNRLFKVLSRLGYKVSLHMDVSAKEIKDIYQKESK 72

  Fly   114 EDHSQNDCFVLAVMSHGTEGKVYAKDM-SYPV--ERLWNPFLGDNCKTLKNKPKLFFIQACRGAN 175
              ..|.:.|:..:.|||.||.:|  |. ..||  ..|::....:|...|...|||||:|||||..
 Frog    73 --MPQGESFISILSSHGNEGLIY--DFYGTPVLLRDLYDILAPNNSPLLAGVPKLFFVQACRGEQ 133

  Fly   176 LEKAVEFSSFAVMTRELVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLC 240
            .::.|...:         .....|....:.::....|.::.:::.:...:|:| ..||.|:|:||
 Frog   134 FDEGVFLET---------DGDTCATDAFSLSLNLPRDSVLMFASSEGHVAFQN-PGGSVFLQTLC 188

  Fly   241 RVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTK 298
            .:|:....|       :||.|:||.:...|||.:||..:   ....||||.:.:.||:
 Frog   189 NLLEGEERN-------LELNRILTRLAHMVAYTFQSQGQ---YGGFKEMPCYTTNLTR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 70/253 (28%)
XB5812047XP_031753853.1 CASc 1..239 CDD:412128 70/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.