DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and Pycard

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_075747.3 Gene:Pycard / 66824 MGIID:1931465 Length:193 Species:Mus musculus


Alignment Length:81 Identity:19/81 - (23%)
Similarity:32/81 - (39%) Gaps:14/81 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KRIIISRPTNEDTYENCARAGIALILNHKDVKGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLT 100
            ::.:|:|.|..|...:.....:.       .:||.|.|..|....|....|..|   |.:: :||
Mouse   117 RQALIARVTEVDGVLDALHGSVL-------TEGQYQAVRAETTSQDKMRKLFSF---VPSW-NLT 170

  Fly   101 FSEINDTLKEVAREDH 116
               ..|:|.:..:|.|
Mouse   171 ---CKDSLLQALKEIH 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 15/63 (24%)
PycardNP_075747.3 Pyrin_ASC-like 5..86 CDD:260033
CARD_ASC_NALP1 111..191 CDD:260039 19/81 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.