DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and Casp7

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_071596.1 Gene:Casp7 / 64026 RGDID:620944 Length:303 Species:Rattus norvegicus


Alignment Length:248 Identity:87/248 - (35%)
Similarity:140/248 - (56%) Gaps:19/248 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RAGIALILNHKD---VKGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVARED 115
            :.|..:|:|:|:   ..|...|.||::|.:.:....:..||:|..::|.:.:::.|.|:..:.||
  Rat    66 KMGKCIIINNKNFDKATGMDVRNGTDKDAEALFKCFRSLGFEVTVYNDCSCAKMQDLLRRASEED 130

  Fly   116 HSQNDCFVLAVMSHGTEGKVYAKDMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAV 180
            ||.:.||...::|||.|..:|.||...|::.|...|.||.||||..||||||||||||..|:..:
  Rat   131 HSNSACFACVLLSHGEENLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGI 195

  Fly   181 EFSSFAVMTRELVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQ 245
            :..|..:...:..|.         |.||..||.|..|||...::|:||...||||:|:||.:|::
  Rat   196 QADSGPINDTDANPR---------YKIPVEADFLFAYSTVPGYYSWRNPGKGSWFVQALCSILNE 251

  Fly   246 AAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTK 298
            ..       :.:|::::||.||.:||..::|.:.:...|:.|::|..:|.|||
  Rat   252 HG-------KDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 87/248 (35%)
Casp7NP_071596.1 CASc 60..301 CDD:237997 87/248 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.