DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and casp23

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001103182.1 Gene:casp23 / 563034 ZFINID:ZDB-GENE-071004-27 Length:446 Species:Danio rerio


Alignment Length:292 Identity:78/292 - (26%)
Similarity:131/292 - (44%) Gaps:62/292 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TSELDLKRIIIS----RPTNEDTYENCARAGIALILNHKDVKGQKQRVGTERDRDDMEATLQGFG 90
            |||...::::..    .|..:.:.:   |..:||::|:.|.| ...|.|.::|...||..|:|.|
Zfish   194 TSEFKAEKLMTEGKCIYPVKDKSPQ---RKRLALLINNVDFK-DNVRTGADKDELSMERLLKGLG 254

  Fly    91 FDVRTFDDLTFSEINDTLKEVA-REDHSQND-CFVLAVMSHGTEGKV------YAKDMSYPVERL 147
            :.|.|..||:...::..:::.: |::|:.:| |||: :||||.|..:      .::|..:|.:.:
Zfish   255 YSVVTLRDLSAQGMSTAMRDFSQRKEHADSDSCFVV-LMSHGDESGICGIFDSSSQDDVFPPDEI 318

  Fly   148 WNPFLGDNCKTLKNKPKLFFIQACRGANLEKAVEFSSFAVMTRELVPEPAAAVQPITYAIPST-- 210
            :......||..|::|||:..||:|||.                    :|.....|.:..|..|  
Zfish   319 FKCLNTPNCAGLRDKPKIILIQSCRGG--------------------KPGNVDVPDSVPIRGTRR 363

  Fly   211 ----ADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVA 271
                .|...|.|:.....|:||.:.||.|||.|..:.     |..|..:.:|.|      .|||.
Zfish   364 EHKEKDFCCFRSSTPDTVSYRNKEKGSHFIQDLVEIF-----NRHAYEDDIEEL------FRKVI 417

  Fly   272 YEYQSNTKNEALNQMKEMP-NFMSTLTKTFQL 302
            .::: .|.:|      :|| ...:||.|.|.|
Zfish   418 MKFR-ETHDE------QMPCKERTTLCKKFYL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 73/262 (28%)
casp23NP_001103182.1 CASc 210..444 CDD:320727 75/276 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587235
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.