DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and casp6

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001011068.1 Gene:casp6 / 496478 XenbaseID:XB-GENE-482797 Length:304 Species:Xenopus tropicalis


Alignment Length:304 Identity:102/304 - (33%)
Similarity:154/304 - (50%) Gaps:31/304 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KNKHKKDKADATKIAHTPTSELDLKRIIISRPTNEDTYENCARAGIALILNHKDVKGQKQ---RV 73
            :||.:|.....|....:.|.|||        |:.|....: .|.|:|||.||:|...|.:   |.
 Frog    24 QNKEQKANVAETDGWTSRTLELD--------PSAEYKMTH-KRRGLALIFNHEDFYWQLRLGSRR 79

  Fly    74 GTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAREDHSQNDCFVLAVMSHGTEGKVYAK 138
            ||..|..::...|...||||:.:.:|...:|.:.::|.:..|||..|||:...:|||.:..:|:.
 Frog    80 GTNTDSMNLNRILTDLGFDVQNYYNLRTLDILEKIQEASTADHSNADCFLCVFLSHGEDRHIYSY 144

  Fly   139 DMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAV----EFSSFAVMTRELVPEPAAA 199
            |....::.|.|.|.||.|::|..|||:|..|||||...:..|    |..|  |....:....||:
 Frog   145 DSLIDIQELTNSFKGDKCESLVGKPKIFIFQACRGEKHDNPVLPTDETDS--VTLTNITEVDAAS 207

  Fly   200 VQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLT 264
            :    |.:|:.||.::.||..:.::|.|...:|||:||.||.||...||:       :|...:||
 Frog   208 L----YTLPAGADFIMCYSVAEGYYSHRETVNGSWYIQDLCEVLKAHAAS-------LEFTEILT 261

  Fly   265 AVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTKTFQLRVKPKT 308
            .|||||:....:...:......|::|.|.|.|||  :|.:|||:
 Frog   262 LVNRKVSQRSVAFCNDPKAIGKKQIPCFSSMLTK--KLFLKPKS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 88/254 (35%)
casp6NP_001011068.1 CASc 51..300 CDD:237997 89/264 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.