DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and casp9

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001007405.2 Gene:casp9 / 492763 ZFINID:ZDB-GENE-030825-5 Length:436 Species:Danio rerio


Alignment Length:356 Identity:96/356 - (26%)
Similarity:157/356 - (44%) Gaps:108/356 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KNKHKKDKADATKIA-----------------HTPTSELDLKRIIISRPT--NEDTYE----NCA 53
            :|.:..:|.|...||                 ::|.||      .:.|||  ..|:.:    :.:
Zfish   111 QNLNHTEKPDKPDIASPRLVPLRPESLPVHKTYSPPSE------TVVRPTRPRRDSIQCYKMDAS 169

  Fly    54 RAGIALILNHKDVKGQKQ---RVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVARED 115
            ..|:.||:|:.:.:...:   |.|:..|.|.:|...:...|:|....:|....|...:..:|::|
Zfish   170 PCGVCLIINNINFEKASELNDRKGSNIDCDKLEKRFKALNFEVTVKRNLKSKRIRHEMASLAKKD 234

  Fly   116 HSQNDCFVLAVMSHGTE-------GKVYAKD-MSYPVERLWNPFLGDNCKTLKNKPKLFFIQACR 172
            ||..||.|:.::|||||       |.|:..| .:.|::.:.|...|.||.:|:.||||||||||.
Zfish   235 HSTYDCCVVIILSHGTEASHNRFPGAVHGVDGPAVPIQIITNYLNGQNCPSLQGKPKLFFIQACG 299

  Fly   173 GANLEKAVEFSSFAVMTRELVPEPAAAVQP-----------------------------ITYAIP 208
            |.  ||.:.|        |:.|:.   |||                             ...::|
Zfish   300 GG--EKDIGF--------EVSPDD---VQPSIGGIDDEMDAIPMSSSSDSLSTASDELDARASLP 351

  Fly   209 STADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYE 273
            :.:||||.||||..:.|:|:.:.|||::::|.|||::    .|.|.:.|.:|.|:          
Zfish   352 TPSDILVSYSTFPGYVSWRDTEAGSWYVENLDRVLEE----NAITDDLVTMLMLV---------- 402

  Fly   274 YQSNTKNEALNQM------KEMPNFMSTLTK 298
                  |:|::|:      |:||...:.|.|
Zfish   403 ------NDAVSQISAKGLYKQMPGSFNFLRK 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 84/291 (29%)
casp9NP_001007405.2 CARD_CASP9 5..88 CDD:176740
CASc 163..432 CDD:237997 84/298 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587243
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.700

Return to query results.
Submit another query.