DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and casp2

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_005157976.1 Gene:casp2 / 373118 ZFINID:ZDB-GENE-030825-3 Length:437 Species:Danio rerio


Alignment Length:350 Identity:91/350 - (26%)
Similarity:136/350 - (38%) Gaps:82/350 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KKDKADATKIAHTPTSELDLKRIIISRPTNEDTYENCARA------------------------- 55
            :|||..:......||.|....   ..||...::.|.|..|                         
Zfish    99 EKDKCFSEPSLSLPTQECVTP---AKRPRTHESMEMCLDADSPVTTAVLPCTPEFYQSHRPQAYP 160

  Fly    56 ------GIALILNH---------KDVKGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEIN 105
                  |:||:|::         .|:     |.|.|.|.:.:........|.|....|||...:.
Zfish   161 MRSCPRGLALVLSNVRFDSANTDLDI-----RRGGEVDEETLRRLFTELDFKVSLHRDLTAEAMR 220

  Fly   106 DTLKEVA-REDHSQNDCFVLAVMSHGTEGKVYAKDMSYPVERLWNPFLGDN--CKTLKNKPKLFF 167
            ..|::.| :::|:..||.|:.::|||.||.||..| ...:|..|...:.||  |..|:||||:||
Zfish   221 RCLEQFAQQQEHAAYDCAVVCLLSHGVEGSVYGTD-GQLLELDWVFEVFDNARCPLLQNKPKMFF 284

  Fly   168 IQACRGANLEKAVEFSSFAVMT------------------RELVPEPAAAVQPITYAIPSTADIL 214
            ||||||..::..|:.......|                  ||...|...  :.:...:|..:|::
Zfish   285 IQACRGEEMDNGVDQLDGQERTQSPGCEQRDAGREGERDNREKKEEKER--ERLRVKLPQRSDMI 347

  Fly   215 VFYSTFDKF--FSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSN 277
            ..::|...|  .:.||...||||||.|...:.|.|.|       ..|..:|..||.::. ..:..
Zfish   348 CGFATLKGFSTAAMRNTKKGSWFIQELNTAIRQRANN-------THLSDILVQVNGQIK-SREGY 404

  Fly   278 TKNEALNQMKEMPNFMSTLTKTFQL 302
            ....|.::.|||..|.|:|.|...|
Zfish   405 APGSAHHRCKEMSEFTSSLCKDLYL 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 80/310 (26%)
casp2XP_005157976.1 CARD_CASP2 7..94 CDD:260040
CASc 158..430 CDD:237997 79/287 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587225
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.