DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and cflara

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001300701.1 Gene:cflara / 373114 ZFINID:ZDB-GENE-030826-3 Length:461 Species:Danio rerio


Alignment Length:279 Identity:66/279 - (23%)
Similarity:103/279 - (36%) Gaps:88/279 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EDTYENCARAGIALILNHKDVKGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKE 110
            |:...|..:.|:.:|:   |..|.        |.:.::.|.:..||.| .|..|.      .|||
Zfish   239 EEYQMNPEQRGLCVII---DCVGY--------DGEMLKHTFECLGFKV-VFHSLL------GLKE 285

  Fly   111 VAR--EDHSQN------DCFVLAVMSHGTEGKVYAKDMSYPVERLWNPFLGDNCKTLKNK----- 162
            ..:  ||.|.|      .|||..::|.||...:.|.|.:.         ||.|.|.||..     
Zfish   286 TQKVLEDLSLNRILQRVRCFVCCLISRGTNTHLLATDSNR---------LGINLKDLKQLFNATK 341

  Fly   163 -PKLFFIQACRGANLEKAVEFSSFAVMTRELVPEPAAAVQPI--TYAIPSTADILVFYSTFDKFF 224
             ||:||.|      |.:..|......|..|.:...|.|.:..  |.::|..||:|          
Zfish   342 CPKIFFTQ------LYRITEAPVMPSMDDEYLETDAPASRQCSNTGSVPMPADVL---------- 390

  Fly   225 SFRNVDDGSWFIQSLC----RVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQ 285
                     |   |:|    ::|:::.....          .|.|:|..:...::.|.  ..|:.
Zfish   391 ---------W---SVCTAEVKLLEESGHQSV----------YLNALNNALLKGHERNV--PILDV 431

  Fly   286 MKEMP-NFMSTLTKTFQLR 303
            |||:. |.:|..:..:||:
Zfish   432 MKEVQRNVLSHDSDNYQLQ 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 62/268 (23%)
cflaraNP_001300701.1 DED 8..87 CDD:307481
DED_c-FLIP_r2 100..180 CDD:260046
CASc 241..461 CDD:320727 65/277 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587233
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.