DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and caspb

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_690840.2 Gene:caspb / 259303 ZFINID:ZDB-GENE-020812-1 Length:404 Species:Danio rerio


Alignment Length:345 Identity:83/345 - (24%)
Similarity:136/345 - (39%) Gaps:90/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GQKNKHKKDKAD-ATKIAHTPTSELDLKRIIISRPTN---------------------------- 45
            ||:||...::.. ..:|...|..:      |||:|.|                            
Zfish    94 GQENKQNSEEPQPIPQIISQPIQQ------IISQPINNAGSEDLQPIQADWQRPRQIIPCSQETK 152

  Fly    46 --------EDTY---ENCARAGIALIL-NHKDVKGQKQRVGTERDRDDMEATLQGFGFDVRTFDD 98
                    :|.|   ....|.|:||:: |.:....|..|.|.:||.::.|..|:..||.|..:.:
Zfish   153 NTLLKAHGDDIYTPRSGTQRKGLALLITNIQFANTQHNRNGADRDEENAEWLLRSLGFAVIKYRN 217

  Fly    99 LTFSEINDTLKEVA-REDHSQNDCFVLAVMSHGT-----EGKVYAKDMSYPVERLWNPFLGDNCK 157
            |:..:|...::..: |.:|...|...:.:|||||     :..|...|..|.:|..::.....||.
Zfish   218 LSGKDIRRAVENFSKRREHEDADSTFIVIMSHGTRIDNKDAIVGVSDDVYFIEETFSHLNSVNCP 282

  Fly   158 TLKNKPKLFFIQACRGANLEKAVEFSSFAVMTRELVPEPAAAVQPITYAIPS----TADILVFYS 218
            .|.:|||:..||||||.        .|..|:.::.|           :|..|    ..|.:.|.|
Zfish   283 ALIDKPKVILIQACRGG--------QSSGVLAQDSV-----------FASDSWVHMEKDFVCFMS 328

  Fly   219 TFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEAL 283
            |....|::||..:||:||..:..|...:|..:       :::.|.    |||....:.:.:.:  
Zfish   329 TMPNTFAYRNPIEGSFFISYIVDVFCSSAHRD-------DIMELF----RKVTLRMEKDQRFQ-- 380

  Fly   284 NQMKEMPNFMST-LTKTFQL 302
            .|.|.:|....| ::|.|.|
Zfish   381 GQAKLLPCIERTSISKRFYL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 69/259 (27%)
caspbNP_690840.2 Pyrin_ASC-like 5..84 CDD:260033
CASc 163..401 CDD:237997 71/270 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587241
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.