DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and Casp3

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_037054.1 Gene:Casp3 / 25402 RGDID:2275 Length:277 Species:Rattus norvegicus


Alignment Length:246 Identity:91/246 - (36%)
Similarity:136/246 - (55%) Gaps:22/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GIALILNHKDV---KGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAREDHS 117
            |:.:|:|:|:.   .|...|.||:.|..::..|.....::||..:|||..||.:.:..|::||||
  Rat    45 GLCIIINNKNFHKSTGMSARNGTDVDAANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHS 109

  Fly   118 QNDCFVLAVMSHGTEGKVYAKDMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAVEF 182
            :...||..::|||.||.::..:....:::|.:.|.||.|::|..|||||.||||||..|:..:|.
  Rat   110 KRSSFVCVILSHGDEGVIFGTNGPVDLKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIET 174

  Fly   183 SSFAVMTRELVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAA 247
            .|..        :...|.|    .||..||.|..|||...::|:||..||||||||||.:|...|
  Rat   175 DSGT--------DDDMACQ----KIPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKLYA 227

  Fly   248 ANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTK 298
                   ..:|.:.:||.||||||.|::|.:.:...:..|::|..:|.|||
  Rat   228 -------HKLEFMHILTRVNRKVATEFESFSLDATFHAKKQIPCIVSMLTK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 91/246 (37%)
Casp3NP_037054.1 CASc 37..277 CDD:214521 91/246 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10454
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.