DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and Casp1

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_036894.3 Gene:Casp1 / 25166 RGDID:2274 Length:402 Species:Rattus norvegicus


Alignment Length:300 Identity:78/300 - (26%)
Similarity:127/300 - (42%) Gaps:59/300 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KKDKADATKIAHTPTSELDLKRIIISRPTNEDTYENCARAGIALILNHKDVKGQKQRVGTERDRD 80
            |::.::...|..|||                       |..:|||:.:.|.:...:|||.:.|..
  Rat   145 KENHSEIYPIMKTPT-----------------------RTRLALIICNTDFQHLSRRVGADVDLR 186

  Fly    81 DMEATLQGFGFDVRTFDDLTFSEINDTLKEVAR-EDHSQNDCFVLAVMSHGTE----GKVYAKDM 140
            :|:..||..|:.|:..::||..|:...|||.|. .:|..:|...|..||||.:    |..|:.::
  Rat   187 EMKLLLQDLGYTVKVKENLTALEMTKELKEFAACPEHKTSDSTFLVFMSHGLQEGICGITYSNEV 251

  Fly   141 S--YPVERLWNPFLGDNCKTLKNKPKLFFIQACRGAN-----LEKAVEFSSFAVMTRELVPEPAA 198
            :  ..|:.::.......|.:||:|||:..||||||..     |:.:|..|....:|..:..:...
  Rat   252 ADILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVGNSEEGFLTDAIFEDDGI 316

  Fly   199 AVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLL 263
            ....|      ..|.:.|.|:.....|:|:...||.||:||.:.:.:.|.:..           |
  Rat   317 KKAHI------EKDFIAFCSSTPDNVSWRHPVQGSLFIESLIKHMKEYAWSCD-----------L 364

  Fly   264 TAVNRKVAYEYQSNTKNEALNQMKEMPNF-MSTLTKTFQL 302
            ..:.|||.:.:      |..:...:||.. ..||||.|.|
  Rat   365 EDIFRKVRFSF------EQPDSRLQMPTTERVTLTKRFYL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 72/260 (28%)
Casp1NP_036894.3 CARD_CASP1-like 6..87 CDD:260036
CASc 152..400 CDD:214521 76/292 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346265
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.