DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and CASP14

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_036246.1 Gene:CASP14 / 23581 HGNCID:1502 Length:242 Species:Homo sapiens


Alignment Length:268 Identity:77/268 - (28%)
Similarity:119/268 - (44%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RPTNEDTYENCARAGIALILNHKDVKGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEIND 106
            |...|:.|: .:.|.:||||     ...|.|.|:|.|.|.:|...:...|:.....|.|..:..:
Human     5 RSLEEEKYD-MSGARLALIL-----CVTKAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQFQE 63

  Fly   107 TLKEVAREDHSQND---CFVLAVMSHGTEGKVYAKD-MSYPVERLWNPFLGDNCKTLKNKPKLFF 167
            .|::..:...|:.|   |..:.:|:||.||.:..:| ....:|.|:......||:.|:.|||::.
Human    64 ELEKFQQAIDSREDPVSCAFVVLMAHGREGFLKGEDGEMVKLENLFEALNNKNCQALRAKPKVYI 128

  Fly   168 IQACRGANLEKAVEFSSFAVMTRELV--PEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVD 230
            ||||||...:..           |.|  .|....::.....||:..|.|..|||.:.:.::|:..
Human   129 IQACRGEQRDPG-----------ETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQ 182

  Fly   231 DGSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMST 295
            .||.|||:|..|.         |.....:|.|||.|.|::| |.:...:.:|   .|..|...||
Human   183 KGSCFIQTLVDVF---------TKRKGHILELLTEVTRRMA-EAELVQEGKA---RKTNPEIQST 234

  Fly   296 LTKTFQLR 303
            |.|...|:
Human   235 LRKRLYLQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 73/253 (29%)
CASP14NP_036246.1 CASc 18..242 CDD:237997 72/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152747
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.