DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and csp-3

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_493011.2 Gene:csp-3 / 190006 WormBaseID:WBGene00000821 Length:139 Species:Caenorhabditis elegans


Alignment Length:126 Identity:37/126 - (29%)
Similarity:61/126 - (48%) Gaps:13/126 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 LEKAVEFSSFAVMTRELVPEPAAAVQ---PITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQ 237
            |::||....|.....:.:|:....::   |......|.||:||.:||...|.||::....:|:||
 Worm    13 LQRAVRCDGFIDNFFDRIPKFFQFMKSKFPSHQTSSSQADLLVSFSTSPGFLSFKDETKDTWYIQ 77

  Fly   238 SLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTK 298
            .|.||:.:.|       :...|..|||..||:|..:|::   ::.:...|:.|.|.|..||
 Worm    78 ELYRVIIENA-------KDTHLADLLTETNRRVVEKYEA---DKVVFVCKQAPEFWSRFTK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 37/126 (29%)
csp-3NP_493011.2 CASc <11..132 CDD:320727 37/126 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162609
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.