DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and Pea15a

DIOPT Version :10

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_035193.1 Gene:Pea15a / 18611 MGIID:104799 Length:130 Species:Mus musculus


Alignment Length:74 Identity:15/74 - (20%)
Similarity:21/74 - (28%) Gaps:32/74 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FSLFGQKNKHKKD------------------------KADATKIAHTPTSELDLKRI-------- 38
            ||.....||..||                        :....||:.....:..|.||        
Mouse    46 FSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEEELDTKLTRIPSAKKYKD 110

  Fly    39 IISRPTNED 47
            ||.:|:.|:
Mouse   111 IIRQPSEEE 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997
Pea15aNP_035193.1 DED_PEA15 2..85 CDD:260045 6/38 (16%)
Microtubule-binding. /evidence=ECO:0000255 98..107 3/8 (38%)
Microtubule-binding. /evidence=ECO:0000255 122..129
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.