powered by:
Protein Alignment Decay and Pea15a
DIOPT Version :9
Sequence 1: | NP_477462.1 |
Gene: | Decay / 42008 |
FlyBaseID: | FBgn0028381 |
Length: | 308 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001316798.1 |
Gene: | Pea15a / 18611 |
MGIID: | 104799 |
Length: | 130 |
Species: | Mus musculus |
Alignment Length: | 74 |
Identity: | 15/74 - (20%) |
Similarity: | 21/74 - (28%) |
Gaps: | 32/74 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 FSLFGQKNKHKKD------------------------KADATKIAHTPTSELDLKRI-------- 38
||.....||..|| :....||:.....:..|.||
Mouse 46 FSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEEELDTKLTRIPSAKKYKD 110
Fly 39 IISRPTNED 47
||.:|:.|:
Mouse 111 IIRQPSEEE 119
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3573 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.