DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and ced-3

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001255708.1 Gene:ced-3 / 178272 WormBaseID:WBGene00000417 Length:503 Species:Caenorhabditis elegans


Alignment Length:311 Identity:91/311 - (29%)
Similarity:148/311 - (47%) Gaps:56/311 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 HKKDKADATKIAHTPTSELDLKRIIISRPTNEDT-YEN-CARAGIALILNHKDVKGQKQRVGTER 77
            |::|    ......||         |||..:|.| |.| .:..|:.||:|::..:....|.||:.
 Worm   213 HEED----MNFVDAPT---------ISRVFDEKTMYRNFSSPRGMCLIINNEHFEQMPTRNGTKA 264

  Fly    78 DRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAREDHSQNDCFVLAVMSHGTEGKVY-AKDMS 141
            |:|::....:..|:.|...|:||...:..|:::.|:.: |..|..:|.::|||.|..:. ..|:.
 Worm   265 DKDNLTNLFRCMGYTVICKDNLTGRGMLLTIRDFAKHE-SHGDSAILVILSHGEENVIIGVDDIP 328

  Fly   142 YPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAVEFSSFAVM-TRELVP----------- 194
            .....:::.....|...|.||||:.|:|||||...:     :.|.|: :.:.||           
 Worm   329 ISTHEIYDLLNAANAPRLANKPKIVFVQACRGERRD-----NGFPVLDSVDGVPAFLRRGWDNRD 388

  Fly   195 ----------EPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAAN 249
                      .|  .||.:....||.||||:.|:|..::.|:||...||||||::|.|....|  
 Worm   389 GPLFNFLGCVRP--QVQQVWRKKPSQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHA-- 449

  Fly   250 EAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTKTF 300
                 :.::::.|||.||:|||..:|:   ::..|.:|:||...|.|.|.|
 Worm   450 -----KDMDVVELLTEVNKKVACGFQT---SQGSNILKQMPEMTSRLLKKF 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 80/270 (30%)
ced-3NP_001255708.1 CARD 2..90 CDD:128424
CASc 235..496 CDD:214521 82/276 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162607
Domainoid 1 1.000 130 1.000 Domainoid score I3239
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I3180
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 1 1.000 - - mtm4766
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.