DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and csp-1

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001022452.1 Gene:csp-1 / 175007 WormBaseID:WBGene00000819 Length:536 Species:Caenorhabditis elegans


Alignment Length:305 Identity:80/305 - (26%)
Similarity:141/305 - (46%) Gaps:40/305 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DTDFSLFGQKNKHKKDKADATKIAHTPTSELDLKRIIISRPTNEDTYE-NCARAGIALILNHKDV 66
            |..:||....::.:..:.||.|..|                .::..|| |....|..|||::::.
 Worm   255 DCSYSLEEYDSQSRMPRTDAKKSNH----------------KHKYCYEMNSNPRGTVLILSNENF 303

  Fly    67 KGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAREDHSQNDCFVLAVMSHGT 131
            |..::||||::|..::....|...:.|....:|....:.:.:||.|...|:  |..:|.::|||.
 Worm   304 KNMERRVGTKQDEVNLTKLFQKLQYTVICKRNLEAESMLEAIKEFAEMAHT--DSIILFLLSHGD 366

  Fly   132 -EGKVYAKDMSYPVERL-WNPFLGDNCKTLKNKPKLFFIQACRGANLEKAVEFSSFAVMTRELVP 194
             .|.|:..| ..||..: .:.:|..: :.|..|||...:.||||..|...|.......:..:..|
 Worm   367 GAGSVFGID-DMPVNVMEVSTYLAYH-QNLLLKPKWVAVSACRGGKLNMGVPVDGLPALEDKCAP 429

  Fly   195 EP------AAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAAT 253
            ..      .:.:.|.|:. ...||:::.:||.|.|.|:|:.:.|:|:|:|:|:|.::.:      
 Worm   430 ISKFWNLMMSRIMPGTFT-SLNADVIISFSTTDGFTSYRDEEAGTWYIKSMCKVFNKHS------ 487

  Fly   254 PEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTK 298
             :.:.||.:||...|.|..:|::...|..|   |:.|..:|.|||
 Worm   488 -KTMHLLDILTETGRNVVTKYENVQGNVVL---KQAPEILSRLTK 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 70/253 (28%)
csp-1NP_001022452.1 SPK 76..188 CDD:214732
CASc 285..533 CDD:214521 73/259 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162602
Domainoid 1 1.000 130 1.000 Domainoid score I3239
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 1 1.000 - - mtm4766
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.