DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and Casp9

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_056548.2 Gene:Casp9 / 12371 MGIID:1277950 Length:454 Species:Mus musculus


Alignment Length:267 Identity:86/267 - (32%)
Similarity:128/267 - (47%) Gaps:42/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GIALILNHKDV---KGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAREDHS 117
            |..||:|:.:.   .|...|.|:..|||.:|...:...|.|...:|||..::...|.|:|..:|.
Mouse   199 GHCLIINNVNFCPSSGLGTRTGSNLDRDKLEHRFRWLRFMVEVKNDLTAKKMVTALMEMAHRNHR 263

  Fly   118 QNDCFVLAVMSHGTE-------GKVYAKD-MSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGA 174
            ..||||:.::|||.:       |.||..| .|..:|::.|.|.|..|.:|..||||||||||.|.
Mouse   264 ALDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIEKIVNIFNGSGCPSLGGKPKLFFIQACGGE 328

  Fly   175 NLEKAVEFSSFAVMTREL-------------VPEPAAAVQPITYAIPSTADILVFYSTFDKFFSF 226
            ..:...|.:..:...|.|             .|.|...:..:: ::|:.:||||.||||..|.|:
Mouse   329 QKDHGFEVACTSSQGRTLDSDSEPDAVPYQEGPRPLDQLDAVS-SLPTPSDILVSYSTFPGFVSW 392

  Fly   227 RNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPN 291
            |:...|||:|::|..:|:|.|.:|....   .|||:..||:.|..|              |::|.
Mouse   393 RDKKSGSWYIETLDGILEQWARSEDLQS---LLLRVANAVSAKGTY--------------KQIPG 440

  Fly   292 FMSTLTK 298
            ..:.|.|
Mouse   441 CFNFLRK 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 86/267 (32%)
Casp9NP_056548.2 CARD_CASP9 5..90 CDD:176740
CASc 190..452 CDD:237997 86/267 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842798
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.