DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and Casp8

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001264855.1 Gene:Casp8 / 12370 MGIID:1261423 Length:500 Species:Mus musculus


Alignment Length:334 Identity:95/334 - (28%)
Similarity:160/334 - (47%) Gaps:53/334 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DDTDFSLFGQKNKHKKDKAD-------ATKIAHTPTSELDLKRI-IISRPTNEDT---------- 48
            |..:.||.|:...:::...:       ..::..:...|:.||.. :...|..:|:          
Mouse   185 DQVNKSLLGKIEDYERSSTERRMSLEGREELPPSVLDEMSLKMAELCDSPREQDSESRTSDKVYQ 249

  Fly    49 YENCARAGIALILNHKD----------VKGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSE 103
            .:|..| |..||:|:.|          ::..|.|.||:.|::.:..|.:...|::.::||.|.:|
Mouse   250 MKNKPR-GYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHFEIVSYDDCTANE 313

  Fly   104 INDTLKEVAREDHSQNDCFVLAVMSHGTEGKVYAKD-MSYPVERLWNPFLGDNCKTLKNKPKLFF 167
            |::.|:.....||...|||:..::|||.:|.||..| ....:..|.:.|.|..|.:|..|||:||
Mouse   314 IHEILEGYQSADHKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTSYFTGSKCPSLSGKPKIFF 378

  Fly   168 IQACRGANLEKAV-EFSSFAVMTRELVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDD 231
            ||||:|:|.:|.| :.:.|......|..:.::...    .||..||.|:..:|.....|:|:..:
Mouse   379 IQACQGSNFQKGVPDEAGFEQQNHTLEVDSSSHKN----YIPDEADFLLGMATVKNCVSYRDPVN 439

  Fly   232 GSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMSTL 296
            |:|:|||||:.|.:..      |:|.::|.:||.||      |..:.|::..|:.|:||.     
Mouse   440 GTWYIQSLCQSLRERC------PQGDDILSILTGVN------YDVSNKDDRRNKGKQMPQ----- 487

  Fly   297 TKTFQLRVK 305
             .||.||.|
Mouse   488 -PTFTLRKK 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 82/259 (32%)
Casp8NP_001264855.1 DED_Caspase_8_r1 23..104 CDD:260041
DD 118..199 CDD:387368 4/13 (31%)
CASc 247..499 CDD:237997 86/272 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842782
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.