DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and Casp3

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001271338.1 Gene:Casp3 / 12367 MGIID:107739 Length:277 Species:Mus musculus


Alignment Length:294 Identity:100/294 - (34%)
Similarity:153/294 - (52%) Gaps:33/294 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KHKKDKADATKIAHTPTSELDLKRIIISRPTNEDTYENCA------RAGIALILNHKDV---KGQ 69
            ::.|...|:..|     :..::|.|..|:..:...|.:.:      ..||.:|:|:|:.   .|.
Mouse     2 ENNKTSVDSKSI-----NNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMGICIIINNKNFHKSTGM 61

  Fly    70 KQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAREDHSQNDCFVLAVMSHGTEGK 134
            ..|.||:.|..::..|..|..:.||..:|||..:|.:.:..|::||||:...||..::|||.||.
Mouse    62 SSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVSKEDHSKRSSFVCVILSHGDEGV 126

  Fly   135 VYAKDMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAVEFSSFAVMTRELVPEPAAA 199
            :|..:....:::|.:.|.||.|::|..|||||.||||||..|:..:|..|..        :...|
Mouse   127 IYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGT--------DEEMA 183

  Fly   200 VQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLT 264
            .|    .||..||.|..|||...::|:||..||||||||||.:|...|       ..:|.:.:||
Mouse   184 CQ----KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSMLKLYA-------HKLEFMHILT 237

  Fly   265 AVNRKVAYEYQSNTKNEALNQMKEMPNFMSTLTK 298
            .||||||.|::|.:.:...:..|::|..:|.|||
Mouse   238 RVNRKVATEFESFSLDSTFHAKKQIPCIVSMLTK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 93/248 (38%)
Casp3NP_001271338.1 CASc 37..277 CDD:214521 93/254 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D417543at33208
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.