DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and Casp14

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_033939.1 Gene:Casp14 / 12365 MGIID:1335092 Length:257 Species:Mus musculus


Alignment Length:269 Identity:73/269 - (27%)
Similarity:119/269 - (44%) Gaps:27/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RPTNEDTYE-NCARAGIALILNHKDVKGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEIN 105
            :|..|:.|: :.||..:.|.:.       |.|.|:|.|.:.:|...:...|:.....|.|..:..
Mouse     9 QPLQEERYDMSGARLALTLCVT-------KAREGSEVDMEALERMFRYLKFESTMKRDPTAQQFL 66

  Fly   106 DTLKEVAREDHSQND---CFVLAVMSHGTEGKVYAKD-MSYPVERLWNPFLGDNCKTLKNKPKLF 166
            :.|.|..:...:..:   |..:.:|:||.||.:..:| ....:|.|:......|||.|:.|||::
Mouse    67 EELDEFQQTIDNWEEPVSCAFVVLMAHGEEGLLKGEDEKMVRLEDLFEVLNNKNCKALRGKPKVY 131

  Fly   167 FIQACRGANLEKAVEFSSFAVM--TRELVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNV 229
            .||||||.:.:...|......:  ..||..:..|.::....:||:..|.|..|||.:.:.|:|:.
Mouse   132 IIQACRGEHRDPGEELRGNEELGGDEELGGDEVAVLKNNPQSIPTYTDTLHIYSTVEGYLSYRHD 196

  Fly   230 DDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNFMS 294
            :.||.|||:|..|......:.....|  |:.||:  .|.:|..|.:....|         |...|
Mouse   197 EKGSGFIQTLTDVFIHKKGSILELTE--EITRLM--ANTEVMQEGKPRKVN---------PEVQS 248

  Fly   295 TLTKTFQLR 303
            ||.|...|:
Mouse   249 TLRKKLYLQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 68/253 (27%)
Casp14NP_033939.1 CASc 10..257 CDD:237997 72/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10454
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.