DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and Casp4

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_446188.2 Gene:Casp4 / 114555 RGDID:621757 Length:373 Species:Rattus norvegicus


Alignment Length:327 Identity:81/327 - (24%)
Similarity:132/327 - (40%) Gaps:77/327 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GQKN---KHKKDKADATKIAHTPTSELDLKRIIISRPTNEDTY---ENCARAGIALILNHKDVKG 68
            |:.|   :..::..|..|:.    |..:..|  :.|...::.|   |...|...|||:.:.:.|.
  Rat    86 GEANLEMEEPEESVDTLKLC----SSEEFTR--LCREKKQEIYPIKETNGRTRKALIICNTEFKH 144

  Fly    69 QKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKE-VAREDHSQNDCFVLAVMSHGT- 131
            ...|.|...|...|:..|:..|:||...::||...:...:|: .|..:|..:|...|.:||||| 
  Rat   145 LSLRYGANIDISGMKGLLEELGYDVVVKEELTAEGMESEMKDFAALSEHQTSDSTFLVLMSHGTL 209

  Fly   132 EG-----------KVYAKDMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANL-EKAVEFSS 184
            :|           .|...|..|.:      |...:|..|::|||:..:|||||.|. |..:..||
  Rat   210 QGLCGTMHSEATPDVLLYDTIYQI------FNNCHCPGLRDKPKVIIVQACRGGNPGEVWIRESS 268

  Fly   185 FAVMTREL-VPE--PAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSL------- 239
            .|...|.: :|.  .|.||: :::.   ..|.:..|||.....|:|:...||:||..|       
  Rat   269 GAHSYRAVDLPRNMEADAVR-MSHV---EKDFIALYSTTPHHLSYRDKTRGSYFISKLISCFRIH 329

  Fly   240 ---CRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNF-MSTLTKTF 300
               |.:.|                         :..:.|.:.:..::|  .:||.. .:|||:.|
  Rat   330 ACSCHLFD-------------------------IFLKVQQSFEKASIN--SQMPTIDRATLTRYF 367

  Fly   301 QL 302
            .|
  Rat   368 YL 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 71/275 (26%)
Casp4NP_446188.2 CARD_CASP1-like 5..85 CDD:260036
CASc 122..371 CDD:214521 74/285 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346259
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3573
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.