DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and CASP12

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001177945.2 Gene:CASP12 / 100506742 HGNCID:19004 Length:341 Species:Homo sapiens


Alignment Length:257 Identity:61/257 - (23%)
Similarity:110/257 - (42%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LILNHKDVKGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKE-VAREDHSQNDCF 122
            |.:.:|:......|.|:|.|...|...|:..|:.|...::||..|:...|:: .|..:|..:|..
Human   101 LNIRNKEFNYLHNRNGSELDLLGMRDLLENLGYSVVIKENLTAQEMETALRQFAAHPEHQSSDST 165

  Fly   123 VLAVMSH-------GTEGKVYAKDMSYPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAV 180
            .|..|||       ||:......|:.:. :.::..|...||::||:|||:..:||||| |....|
Human   166 FLVFMSHSILNGICGTKHWDQEPDVLHD-DTIFEIFNNRNCQSLKDKPKVIIMQACRG-NGAGIV 228

  Fly   181 EFSS----FAVMTRELVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCR 241
            .|::    .:..|...:.:.......:|.| ....|.:.|.|:.....|:|:..:||.||..:..
Human   229 WFTTDSGKASADTHGRLLQGNICNDAVTKA-HVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIY 292

  Fly   242 VLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPNF-MSTLTKTFQL 302
            ...:.:.:..           |..:.:||.:.:      |..|.:.::|.. ..::|:.|.|
Human   293 YFREYSWSHH-----------LEEIFQKVQHSF------ETPNILTQLPTIERLSMTRYFYL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 60/255 (24%)
CASP12NP_001177945.2 CARD_CASP1-like 6..88 CDD:260036
CASc 103..339 CDD:214521 60/255 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152743
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.