DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and casp2

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_012809163.2 Gene:casp2 / 100486813 XenbaseID:XB-GENE-482390 Length:421 Species:Xenopus tropicalis


Alignment Length:271 Identity:82/271 - (30%)
Similarity:122/271 - (45%) Gaps:28/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NEDTYE--NCARAGIALILNHKDVKGQ--KQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEIN 105
            ::..|:  :|.| |.|||:::...:.|  ..|.|.|.|...:|......||.|....:|....:.
 Frog   158 HQQAYKMHSCPR-GRALIISNVAFETQDLDHRYGGEVDVASLEKLFSSLGFQVEVRRNLNAQNMM 221

  Fly   106 DTLKEV-AREDHSQNDCFVLAVMSHGTEGKVYAKDMSYPVERLWNPFLG-DN--CKTLKNKPKLF 166
            ..|... |...||..|..|:||:|||.:|.||..|..  :.:|.:.|.. ||  |..|:||||:|
 Frog   222 SQLGAFSALPAHSALDSCVVAVLSHGLDGAVYGTDGK--LVQLQDVFTAMDNAHCPQLQNKPKMF 284

  Fly   167 FIQACRGANLEKAVEFSSFAVMTRELVPEPA-----AAVQPITYAIPSTADILVFYSTFDKFFSF 226
            |||||||...::.|:...    .||....|.     |..:.|...:|:.:|::..|:......|.
 Frog   285 FIQACRGEEADRGVDQRD----GREQSASPGCEQSDAGREDIKVRLPTQSDMICAYACLKGTVSL 345

  Fly   227 RNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMPN 291
            ||...||||:|.|..|..|.:.|       ..:..:|..||..:. |.:.:......::.|||..
 Frog   346 RNTKRGSWFVQDLVSVFSQYSKN-------THVADMLVKVNALIK-EREGHAPGTEFHRCKEMSE 402

  Fly   292 FMSTLTKTFQL 302
            :.|||.:...|
 Frog   403 YCSTLCRDLYL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 79/258 (31%)
casp2XP_012809163.2 DD 5..86 CDD:417479
CASc 161..414 CDD:237997 82/268 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.