DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Decay and casp20

DIOPT Version :9

Sequence 1:NP_477462.1 Gene:Decay / 42008 FlyBaseID:FBgn0028381 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001129724.1 Gene:casp20 / 100192215 ZFINID:ZDB-GENE-081022-114 Length:347 Species:Danio rerio


Alignment Length:236 Identity:85/236 - (36%)
Similarity:121/236 - (51%) Gaps:20/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GIALILNHKDVKGQKQRVGTERDRDDMEATLQGFGFDVRTFDDLTFSEINDTLKEVAREDHSQND 120
            ||.:|:|:.|....|:|.|::.|:..:....:..||:|....:.|.:|:.:.|:.:.|.  ...|
Zfish   114 GICVIINNVDFTSMKERRGSDEDQKYLAKVFRWLGFEVVAHRNKTAAEMKNILQALGRT--VDGD 176

  Fly   121 CFVLAVMSHGTEGKVYAKDMS-YPVERLWNPFLGDNCKTLKNKPKLFFIQACRGANLEKAVEFSS 184
            |||..|:|||.:..|...|.| ..|:.:.:||.|.||:.|..||||||||||||...:..|...:
Zfish   177 CFVCCVLSHGMKEGVCGTDGSLVSVDEIRDPFTGINCQKLVGKPKLFFIQACRGQRKQLRVNAQA 241

  Fly   185 FAVMTRELVPEPAAAVQPITYAIPSTADILVFYSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAAN 249
            ......|...|.......||  |||..|.|:..||.|...|:|..|:||||||||||.|      
Zfish   242 DGPGDGESEMEVDGDDFDIT--IPSDTDFLIARSTTDGHVSYRKPDEGSWFIQSLCRNL------ 298

  Fly   250 EAATPEGVELLRLLTAVNRKVAYEYQSNTKNEALNQMKEMP 290
            |...|.|.::|.:|.:||.:|:.        :.|:. |:||
Zfish   299 EKHCPLGADILTILLSVNNEVSI--------QGLHS-KQMP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DecayNP_477462.1 CASc 54..302 CDD:237997 85/236 (36%)
casp20NP_001129724.1 CARD 10..82 CDD:260018
CASc 106..343 CDD:237997 85/236 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.