DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Decay and si:ch211-195h23.3

DIOPT Version :9

Sequence 1:	NP_477462.1	Gene:	Decay / 42008	FlyBaseID:	FBgn0028381	Length:	308	Species:	Drosophila melanogaster
Sequence 2:	XP_021334238.1	Gene:	si:ch211-195h23.3 / 100170660	ZFINID:	ZDB-GENE-070912-174	Length:	1001	Species:	Danio rerio

Alignment Length:	125	Identity:	25/125 - (20%)
Similarity:	48/125 - (38%)	Gaps:	12/125 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   154 DNCKTLKNKPKLFFIQACRGAN--LEKAVEFSSFAVMTRELVPEPAAAVQPITYAIPSTADILVF 216
            ::||.:.::|::......:|..  ..:.:..|.|....|..:.:..::|..|..::.|...|
Zfish   878 EDCKEVWSRPRVSLKAPSQGVEPPEHRMISGSEFVDALRGKLIQRVSSVMAIADSLRSKHMI--- 939

  Fly   217 YSTFDKFFSFRNVDDGSWFIQSLCRVLDQAAANEAATPEGVELLRLLTAVNRKVAYEYQS 276
              |.:.:....|.|.....::.|...||...|:..|     |..|||......:..|.:|
Zfish   940 --TDELYSELHNADTNQRKMRCLFMALDSGGASVKA-----EFYRLLKKNEPHLVEELES 992

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Decay	NP_477462.1	CASc	54..302	CDD:237997	25/125 (20%)
si:ch211-195h23.3	XP_021334238.1	P-loop_NTPase	51..307	CDD:328724
		GBP_C	315..602	CDD:293879
		coiled coil	573..584	CDD:293879
		coiled coil	593..602	CDD:293879
		FIIND	645..885	CDD:316110	2/6 (33%)
		CARD_ASC_NALP1	910..991	CDD:260039	19/90 (21%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3573
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900