DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr89a and egl-47

DIOPT Version :9

Sequence 1:NP_650555.2 Gene:Gr89a / 42007 FlyBaseID:FBgn0038440 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001023728.1 Gene:egl-47 / 183687 WormBaseID:WBGene00001211 Length:522 Species:Caenorhabditis elegans


Alignment Length:320 Identity:49/320 - (15%)
Similarity:84/320 - (26%) Gaps:162/320 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LLTSMAP----FVLWKSAAMYEATNVRHSMVFKTIALATMTGDVCISLA---------------- 93
            ::|:..|    ||:..||..:::    |..:.|||.:.    |||...|                
 Worm   186 MITATKPVINVFVIVLSAIKFKS----HQRLLKTIDMV----DVCFRSAFGVSPPLRIYKFVFFF 242

  Fly    94 ----------------------LLGNH--------------LWN--------------RRELANL 108
                                  :.|.|              |||              |.....|
 Worm   243 TLLIIFFSALILKVVEFVGTGEIFGEHILTDCSFILVPVLSLWNIIPLLYYHLYNILVRFYCRTL 307

  Fly   109 VNDLARLHRRRRLSW------------------------------WSTLFLWL------------ 131
            :..:.|.|::|..|.                              ||.|.|.|            
 Worm   308 IKSMNREHKKRHFSLKFYYEQFTRITNVQEAVGDVFNPLLLFSLAWSLLVLCLTLYFLSEPTSTL 372

  Fly   132 ----------------KLLLSLYDLLCSVPFLKGAGGRLPWSQLVAYGVQLYFQHVASVYGNG-- 178
                            ||.::::..:|             |:   ||.|.:...|:..:...|  
 Worm   373 LVPITPEQVTNPKIREKLNITVHVKIC-------------WA---AYQVVMAILHIIIICSTGMM 421

  Fly   179 -------IFGGILLMLECYN-QLEREEPTNLARLLQKEYSWLRLIQRFVKLFQLGIFLLV 230
                   |...:|.::...| .|:|.:.:.....:..::.|...:.|...|.:...|.|:
 Worm   422 TNETTRQIVNAVLRIVPDANADLDRFQISCFVHKMTTQFMWGMTVWRAFPLERTTFFTLI 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr89aNP_650555.2 7tm_7 10..351 CDD:285581 49/320 (15%)
egl-47NP_001023728.1 7tm_7 110..495 CDD:303125 49/320 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.