DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cad89D and Pcdhb16

DIOPT Version :9

Sequence 1:NP_650554.3 Gene:Cad89D / 42006 FlyBaseID:FBgn0038439 Length:2240 Species:Drosophila melanogaster
Sequence 2:NP_444371.3 Gene:Pcdhb16 / 93887 MGIID:2136752 Length:802 Species:Mus musculus


Alignment Length:956 Identity:205/956 - (21%)
Similarity:334/956 - (34%) Gaps:357/956 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   839 KSKRRLPRRLVGDANIKLRYIIANQQEVV---NKISI---TEDGTLLTLTGLDREQQPSYELTVI 897
            |..|.....||.|..:....:.....:|:   ||:.:   .|.|.||....:|||:...:....:
Mouse    40 KEGRSFVTNLVKDLGLGQLELSRRGAKVISKGNKLHLQLDQETGDLLLNEKVDREKLCGHTEPCL 104

  Fly   898 VEYSTGLVSGAGIYQVNIKVDDVNDNAPKFNALTYVGLINENCVVGTELSMNHAILIQDADEGPN 962
            :.:...|.:...|:|..::|.|:||::|:|.....:..|:|:.:.|....:.:|   ||.|.|.|
Mouse   105 LSFQVLLDNPLDIFQAELEVTDINDHSPEFLDKEIMLKISESSLPGATFPLKNA---QDMDVGQN 166

  Fly   963 AEFRVQLQGDYSDEFSIEYVNGTSSENSTHHKMPSTTGAFNIFNLTDQWNDEFKYQELHTTFMQT 1027
            .          .|::.|                 |:...|.:  ||.:.:|..||.||       
Mouse   167 G----------IDKYLI-----------------SSNSYFRV--LTRKRSDGKKYPEL------- 195

  Fly  1028 NFKLSSGPYFRISYTGKRGLDREKQQLYNLKIIAADTGGL--SGYAHLTVLVADVNDNAPMFERI 1090
                          ...|.||||::....|.:.|.|.|.|  ||...:.:.|.|:|||||.||::
Mouse   196 --------------VLDRALDREEEAELRLTLTAQDGGSLPRSGTTEVHIEVLDINDNAPQFEQL 246

  Fly  1091 SVFKDSRLEIREYTTDMEIYFVESSSGMTAPQATAAMMLAPPPYHIPGSPRFNVDRERSVGAGLG 1155
                                |.::                    .||                  
Mouse   247 --------------------FYKA--------------------QIP------------------ 253

  Fly  1156 VVARAKSRRRMVRALTTKCPLFAIYEDTPVGTKVLQLSASDEDFGKNALLHYEL--QGEQVERTP 1218
                                     ||:|:|..::.:||:|:|.|.|..:.|.|  ..:.:.:| 
Mouse   254 -------------------------EDSPIGFLIITVSATDKDIGVNGQISYSLFQVSDDISKT- 292

  Fly  1219 GMPMLRVHGVKYFAIDKLSGEL----SVNYPLSANIEIMLNLTVTDIDGLKDSTCLRFTVMDVNN 1279
                        |:|..|:||:    .:::..:.:.||  |:...|.........:...|:|||:
Mouse   293 ------------FSIHPLTGEVRLKEHLDFEKTQSYEI--NIEARDAGTFSGKCTILAQVLDVND 343

  Fly  1280 HAPTFKKSWYSFDTPEGEYKDSVLGQLTAIDMDFGENANITYTLSDSHLPFTIKPASG----VLK 1340
            |||....|.::....| ...::::...:..|:|.|||..::.::.|. |||.:|| ||    .|.
Mouse   344 HAPEIILSAFTNSILE-NLPETMVAVFSVSDLDSGENGKVSCSIQDD-LPFFLKP-SGENFYTLL 405

  Fly  1341 IGGQLDRELKDKYSFQVIATD-NAPVMQRMSSSVDVEVNVLDINDNRPEFIGYDDQTKAVKFIPS 1404
            ....||||...:|:..:...| .:|:::   :.|::.|.|.|||||.|.|    .||.       
Mouse   406 SQKPLDRESVAEYNITITVADMGSPILK---TQVNLTVQVSDINDNAPIF----TQTS------- 456

  Fly  1405 VADRTLMLPVYKAYLDRSTQPGTFVRQLTAIDKDNVGNGNGLVLYSI----RHQEMQAPLFQIDS 1465
                      |..::..:..|...:..::|.|.|:..|.:  :.||:    .||...|....|::
Mouse   457 ----------YTMFIRENNSPALHIGTISATDSDSGSNAH--ITYSLLPPHDHQLALASFISINA 509

  Fly  1466 RDGTISTISRINGYNDYEHLNV---SVIASDVGSPALSATAIVIVNLQGQAVTDPPKSTPKPEPP 1527
            .:|.:..:..:    |||.|..   .|.|:|.||||||:.|:|.:                    
Mouse   510 DNGQLFVLRAL----DYEALQAFEFHVGATDGGSPALSSQALVRM-------------------- 550

  Fly  1528 ANVTVFQHAYYEVKLTENNEAPIEVMRLNLSAGLNPENYRWSLWLEEGLDETDAHPPFEYDAKNM 1592
                        |.|.:|:.||.                                          
Mouse   551 ------------VVLDDNDNAPF------------------------------------------ 561

  Fly  1593 LLYALKPFDREHISRYQLRIRADRLSREARNYARVSYPVVDERIEGLSLNECRILVHIADENDNA 1657
                                              |.||:                     :|.:|
Mouse   562 ----------------------------------VLYPM---------------------QNASA 571

  Fly  1658 PKFRGNGQPIVAVLPQSASFGYPVTRVEANDLDEGLNAEIRYRLL--NEPARLFGIDELSGNI-- 1718
                    |...:||::|..||.||:|.|.|.|.|.||.:.::||  .||. ||.:...:|.:  
Mouse   572 --------PYTELLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPG-LFSVWAHNGEVHT 627

  Fly  1719 -RLLGELSRTEHIYGFDVKATDRMGADDGRSGIVNVFVYIINEAKQ 1763
             |||.|  |..|.:...:...|  ..|..||..|.:.|.:::...|
Mouse   628 SRLLSE--RDVHKHRLILLVKD--NGDPPRSASVTLHVLLVDGFSQ 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cad89DNP_650554.3 Cadherin_repeat 183..290 CDD:206637
Cadherin_repeat 325..407 CDD:206637
Cadherin_repeat 416..524 CDD:206637
Cadherin_repeat 534..626 CDD:206637
Cadherin_repeat 641..>714 CDD:206637
CA 851..925 CDD:214520 18/79 (23%)
CA 1026..1085 CDD:214520 17/60 (28%)
Cadherin_repeat 1177..1280 CDD:206637 26/108 (24%)
Cadherin_repeat 1289..1385 CDD:206637 28/100 (28%)
Cadherin_repeat 1414..1510 CDD:206637 28/102 (27%)
CA 1576..1658 CDD:214520 4/81 (5%)
Cadherin_repeat 1666..1760 CDD:206637 34/98 (35%)
Pcdhb16NP_444371.3 Cadherin_2 32..113 CDD:285466 16/72 (22%)
Cadherin_repeat 141..239 CDD:206637 35/150 (23%)
Cadherin_repeat 248..344 CDD:206637 28/173 (16%)
Cadherin_repeat 356..448 CDD:206637 28/97 (29%)
Cadherin_repeat 456..558 CDD:206637 31/156 (20%)
Cadherin_repeat 572..665 CDD:206637 34/97 (35%)
Cadherin_C_2 687..770 CDD:293101
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.